Scaffold SL_9KL_010_SEDDRAFT_10100104

Overview

Basic Information

• Taxon OID: 3300000365
• Scaffold ID: SL_9KL_010_SEDDRAFT_10100104
• Source Dataset Name: Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 9KL_010_SED
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1036
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location

• Location Name: Russia: Kulunda Steppe, Lake Tanatar
• Coordinates
  • Lat. (^o): 51.39
  • Long. (^o): 79.48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055545	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_9KL_010_SEDDRAFT_101001041	F055545	N/A	QLARRIAVGHQSFKLSTVGGAKIKADVGASHALSMTHPDTIGNLVSGGEH*