NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ICChiseqgaiiFebDRAFT_11156271

Scaffold ICChiseqgaiiFebDRAFT_11156271


Overview

Basic Information
Taxon OID3300000363 Open in IMG/M
Scaffold IDICChiseqgaiiFebDRAFT_11156271 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Continuous Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)525
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m).1016
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F021376Metagenome / Metatranscriptome219Y
F033892Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
ICChiseqgaiiFebDRAFT_111562711F021376AGGVYLKHLSSLQFLTYISFFAVVMAALFKFVPGRAPPVRETPYPEDELHAHDPKAAKYFLAGGFFLVLGSLHM
ICChiseqgaiiFebDRAFT_111562712F000280GGAGMAEEQRPARPLVGYRDVGGDVRHSRPQMIRSWIILAVLVLLYFGWTLTVYFLEPGLR*
ICChiseqgaiiFebDRAFT_111562713F033892N/AYTTWDTPEQLEAFLDRGYTFERMLADVGLQAEPPRLMEKIF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.