NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F033892

Metagenome / Metatranscriptome Family F033892

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F033892
Family Type Metagenome / Metatranscriptome
Number of Sequences 176
Average Sequence Length 44 residues
Representative Sequence HCYTTWDTPEQLEAFLERGYTFERMLDDVAGVAAEPTLVMEKVF
Number of Associated Samples 138
Number of Associated Scaffolds 176

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.90 %
% of genes near scaffold ends (potentially truncated) 84.09 %
% of genes from short scaffolds (< 2000 bps) 81.25 %
Associated GOLD sequencing projects 133
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.364 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.704 % of family members)
Environment Ontology (ENVO) Unclassified
(31.250 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.068 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 0.00%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 176 Family Scaffolds
PF00115COX1 15.34



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.36 %
UnclassifiedrootN/A13.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459016|G1P06HT01BD0ZMAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11156271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300004114|Ga0062593_101372799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300004114|Ga0062593_101558720All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria715Open in IMG/M
3300004153|Ga0063455_100746389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300004153|Ga0063455_100891415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300004156|Ga0062589_100578255All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300004479|Ga0062595_100600199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria857Open in IMG/M
3300004643|Ga0062591_100261090All Organisms → cellular organisms → Bacteria1330Open in IMG/M
3300004643|Ga0062591_101992822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300005166|Ga0066674_10271160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria801Open in IMG/M
3300005174|Ga0066680_10049736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2459Open in IMG/M
3300005174|Ga0066680_10655745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300005174|Ga0066680_10834695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria552Open in IMG/M
3300005179|Ga0066684_11077469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300005187|Ga0066675_10341617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300005187|Ga0066675_10920751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300005294|Ga0065705_11127203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300005354|Ga0070675_101256819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300005435|Ga0070714_101229793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria731Open in IMG/M
3300005439|Ga0070711_101718976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300005444|Ga0070694_101455584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300005446|Ga0066686_10956980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300005450|Ga0066682_10647015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300005451|Ga0066681_10446995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria794Open in IMG/M
3300005529|Ga0070741_10088739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3348Open in IMG/M
3300005540|Ga0066697_10834822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300005545|Ga0070695_101056894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300005560|Ga0066670_10278042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1017Open in IMG/M
3300005561|Ga0066699_10146370All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300005561|Ga0066699_11169506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300005568|Ga0066703_10821960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria531Open in IMG/M
3300005569|Ga0066705_10663830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300005575|Ga0066702_10604441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300005587|Ga0066654_10295386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300005614|Ga0068856_101081483All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300005615|Ga0070702_101819784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300006034|Ga0066656_10885426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300006046|Ga0066652_101738687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300006175|Ga0070712_101438766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300006755|Ga0079222_11768421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300006796|Ga0066665_10445910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1068Open in IMG/M
3300006797|Ga0066659_10863308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300006797|Ga0066659_11381861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300009012|Ga0066710_101778201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300009012|Ga0066710_101865909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300009012|Ga0066710_101962618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300009090|Ga0099827_11121496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300009137|Ga0066709_100076084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3976Open in IMG/M
3300009137|Ga0066709_101611570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria928Open in IMG/M
3300009137|Ga0066709_103218409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria595Open in IMG/M
3300009176|Ga0105242_10255157All Organisms → cellular organisms → Bacteria1582Open in IMG/M
3300010147|Ga0126319_1020095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300010304|Ga0134088_10318281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300010337|Ga0134062_10589224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300010364|Ga0134066_10163365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria710Open in IMG/M
3300010396|Ga0134126_11373217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300010397|Ga0134124_11358448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria735Open in IMG/M
3300012096|Ga0137389_10785669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300012198|Ga0137364_10766557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300012198|Ga0137364_10809794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300012198|Ga0137364_10985800All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300012201|Ga0137365_10910393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300012208|Ga0137376_10917857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300012208|Ga0137376_11101466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300012212|Ga0150985_105964503Not Available765Open in IMG/M
3300012354|Ga0137366_10593156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300012356|Ga0137371_10355248All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300012356|Ga0137371_10992008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300012356|Ga0137371_11444812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300012359|Ga0137385_11510755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300012882|Ga0157304_1089460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300012930|Ga0137407_10112863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2349Open in IMG/M
3300012937|Ga0162653_100046665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300012961|Ga0164302_11677581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300012975|Ga0134110_10083746All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300012975|Ga0134110_10401034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300012976|Ga0134076_10185599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300012977|Ga0134087_10076083All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300012977|Ga0134087_10251573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300012977|Ga0134087_10270572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300012984|Ga0164309_11078157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300013297|Ga0157378_11328016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300013306|Ga0163162_11891110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300014150|Ga0134081_10414585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300014166|Ga0134079_10146152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300014487|Ga0182000_10551978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300014488|Ga0182001_10100063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300014829|Ga0120104_1071517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300015054|Ga0137420_1492206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4191Open in IMG/M
3300015357|Ga0134072_10306175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300017657|Ga0134074_1183425All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300017997|Ga0184610_1082269All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300018027|Ga0184605_10081117All Organisms → cellular organisms → Bacteria1414Open in IMG/M
3300018056|Ga0184623_10392857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300018061|Ga0184619_10276155All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300018061|Ga0184619_10345210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M
3300018063|Ga0184637_10579942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300018071|Ga0184618_10236167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300018433|Ga0066667_10816236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria795Open in IMG/M
3300018482|Ga0066669_10506828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1045Open in IMG/M
3300018482|Ga0066669_11173514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300019269|Ga0184644_1128478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300019869|Ga0193705_1050338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300019890|Ga0193728_1292014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300020018|Ga0193721_1142832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300020018|Ga0193721_1170787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300021078|Ga0210381_10320364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300022737|Ga0247747_1001404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2402Open in IMG/M
3300022737|Ga0247747_1024214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria681Open in IMG/M
3300025552|Ga0210142_1005798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2245Open in IMG/M
3300025929|Ga0207664_11439253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300025933|Ga0207706_10638098All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300025934|Ga0207686_10599452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300026300|Ga0209027_1054524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1496Open in IMG/M
3300026323|Ga0209472_1226179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300026331|Ga0209267_1261048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300026342|Ga0209057_1175916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300026537|Ga0209157_1267810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300026550|Ga0209474_10080907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2232Open in IMG/M
3300026750|Ga0207483_100813All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300026829|Ga0207580_1003551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300027718|Ga0209795_10092076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300028708|Ga0307295_10016820All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300028710|Ga0307322_10052315All Organisms → cellular organisms → Bacteria998Open in IMG/M
3300028710|Ga0307322_10067943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria888Open in IMG/M
3300028713|Ga0307303_10185388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300028715|Ga0307313_10232907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300028718|Ga0307307_10237543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300028719|Ga0307301_10211811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300028720|Ga0307317_10218502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300028720|Ga0307317_10332850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300028722|Ga0307319_10203701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300028754|Ga0307297_10007753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2754Open in IMG/M
3300028768|Ga0307280_10182200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300028778|Ga0307288_10074747All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300028784|Ga0307282_10145087All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300028784|Ga0307282_10206409All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300028784|Ga0307282_10366169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300028784|Ga0307282_10559406Not Available555Open in IMG/M
3300028787|Ga0307323_10369809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300028807|Ga0307305_10107361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1289Open in IMG/M
3300028807|Ga0307305_10177353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria982Open in IMG/M
3300028811|Ga0307292_10207014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300028824|Ga0307310_10369696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria707Open in IMG/M
3300028828|Ga0307312_10933801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300028880|Ga0307300_10052965All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300028880|Ga0307300_10116527All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300028884|Ga0307308_10024680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2776Open in IMG/M
3300030336|Ga0247826_10039777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2516Open in IMG/M
3300031058|Ga0308189_10027995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1399Open in IMG/M
3300031093|Ga0308197_10343871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300031421|Ga0308194_10106812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300031421|Ga0308194_10175022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria679Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.05%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.09%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.55%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.70%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.14%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.14%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.14%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.14%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.14%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.14%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.14%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.14%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.57%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.57%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.57%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.57%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.57%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.57%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.57%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.57%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.57%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.57%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.57%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.57%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.57%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459016Litter degradation ZMR2EngineeredOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300025552Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026750Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes)EnvironmentalOpen in IMG/M
3300026829Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027068Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300027718Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
2ZMR_011383702170459016Switchgrass, Maize And Mischanthus LitterVTTWDTPEQLEAYLERGYTFDRMLIDVSEVIAEPTVVVEKIF
ICChiseqgaiiFebDRAFT_1115627133300000363SoilYTTWDTPEQLEAFLDRGYTFERMLADVGLQAEPPRLMEKIF*
Ga0062593_10137279933300004114SoilTWDTPEQLEAFLERGYTFDRMLADVAGITAQPTLVMEKVF*
Ga0062593_10155872033300004114SoilFVEPVGPDYRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAEILAEPTRMMEKIF*
Ga0063455_10074638913300004153SoilGEIRLQCYATWDTPEQLEGFLERGYTLERMLADVGAPAPERTLIMEKVF*
Ga0063455_10089141513300004153SoilWDTPEQLEAFLERGYTVERLLADVGGIHAERSIVLEKLF*
Ga0062589_10057825513300004156SoilTAYSTWDTPEQLEAFLERGYTMQRMLMDTAGIAVESSRVVEKVF*
Ga0063356_10091087433300004463Arabidopsis Thaliana RhizosphereCYTTWDTAAQLEAFLERGYTFDRLLADLGPGLEPERSLVMEKVF*
Ga0062595_10060019913300004479SoilVHCYTTWDTPDQLEVFLERGYTFERMLADAGGLEPQRSLVMEKVF*
Ga0062591_10026109033300004643SoilTWDTLEQLEAFLERGYTFERMLVDVAEILAEPTRMMEKIF*
Ga0062591_10199282233300004643SoilYTTWDTSWQLEAFLERGYTLERLLADFGDLSAERSLVMEKVF*
Ga0066674_1027116033300005166SoilPDGMRLECFTTWDTPEQLDAFLERGYTIERMLADVADLTVERTRLMEKVF*
Ga0066680_1004973633300005174SoilVLVHCYTTWDTPGQLEVFLERGYTFERMLADVGAGADAQRSLVMEKVF*
Ga0066680_1065574513300005174SoilVRIHCYTTWDTPEQLEAFLERGYTFERMLHDVAGITPQPTLVMEKIF*
Ga0066680_1083469513300005174SoilRGAVRIHCYTTWDTPEQLEAFLDRGYTFARMLADVAELEAEPTRVMEKVF*
Ga0066684_1107746933300005179SoilHCYTTWDTPEQLEAFLERGYTFERMLIDVAEVIAQPTIVMEKVF*
Ga0066675_1034161713300005187SoilCYTTWDTPGQLEAFLERGYTVERMLLDIAGVRAETTLLMEKIF*
Ga0066675_1092075133300005187SoilHCYTTWDTPQQLEAFLERCYTFERMLLDVANVRAEPTHLMEKIF*
Ga0065705_1112720333300005294Switchgrass RhizosphereWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF*
Ga0070675_10125681913300005354Miscanthus RhizosphereEAEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF*
Ga0070714_10122979333300005435Agricultural SoilHCYTTWDTPEQLEAFLERGYTFERMLDDVAGVAAEPTLVMEKVF*
Ga0070711_10171897633300005439Corn, Switchgrass And Miscanthus RhizosphereRVHCYTTWDTPEQLEAFLERGYTFERMLRDVAELPTERTYVMEKVF*
Ga0070694_10145558433300005444Corn, Switchgrass And Miscanthus RhizosphereSGSDYRLHCYTTWDTPEQLEAFLERGYTFERMLADVAGLQADPTLVMEKVF*
Ga0066686_1095698013300005446SoilAEGAVRIHCYTTWDTPEQLETYLERGYTFERMLVDVAGITAQPTLVMEKVF*
Ga0066682_1064701533300005450SoilHCYTTWDTPEQLEAFLERGYTVDRMLVDIVGVEPEVTRPMEKIF*
Ga0066681_1044699513300005451SoilWDTPEQLEGFLERGYTLERMLADVGAPAPERTLIMEKVF*
Ga0070741_1008873933300005529Surface SoilAVQLEAFLERGYTFERLLADLGVPDPERNLVMEKVF*
Ga0066697_1083482233300005540SoilPGQLEVFLERGYTFERLLADVGSGLTPSRSLVMEKVF*
Ga0070695_10105689433300005545Corn, Switchgrass And Miscanthus RhizosphereCYTTWDTPEQLEAFLERGYTVERMLVDVAGIAAEPTRVVEKVF*
Ga0066670_1027804213300005560SoilVRVHCYTTWDTPEQLEAFMERGYTFERMLRDVAELPIERTYVMEKVF*
Ga0066699_1014637013300005561SoilVHCYTVWDTPEQLEAYLERGYTFDRMLKGVANLSADPTRFMEKVF*
Ga0066699_1116950613300005561SoilAAGDIVRIYCFTTWDTPEQLEAFLERGYTFERMLGDVTGIRAQPVVLMEKVF*
Ga0066703_1082196033300005568SoilEGAVRIHCYTTWDTPEQLEAYLERGYTFERMLVDVAGITAQPTLVMEKIF*
Ga0066705_1066383013300005569SoilRVHCYTTWDTPEQLEAFMERGYTFERMLRDVAELPIERTYVMEKVF*
Ga0066702_1060444113300005575SoilRVHCYTTWDTPEQLEVFLERGYTFERMLADVAELTADRTYVMEKVF*
Ga0066654_1029538633300005587SoilTWDTAEQLEVFLERGYTFERMLQDVAQLGVERSDVMEKVF*
Ga0068856_10108148313300005614Corn RhizosphereFRIDCYTTWDTPEQLEAFLERGYTLERMLGDVCGIAVESTRVVEKVF*
Ga0070702_10181978413300005615Corn, Switchgrass And Miscanthus RhizosphereTTWDTPEQLEAYLTRGYTFERMLADVADLDAEAPQVMEKIF*
Ga0066656_1088542613300006034SoilQLEAFLERGYTFERLLADIGSGLGPARSLVMEKVF*
Ga0066652_10173868733300006046SoilHCYTVWDTPEQLEAFLERGYTVARMLADVSGVEPEETRIMEKVF*
Ga0070712_10143876613300006175Corn, Switchgrass And Miscanthus RhizosphereVHAEAEGAVRIHCYTTWDTPEQLEAFLERGYTFERMLHDVGGITAQPTLVMEKIF*
Ga0079222_1176842113300006755Agricultural SoilLEDSGDFLIHCYSTWDTPEQLEAFLERGYTVERMLDSVAGISATPPRIMEKVF*
Ga0066665_1044591013300006796SoilWDTQEQLEAFLERGYTFERMLRDVAELGVERNYVMEKVF*
Ga0066659_1080607333300006797SoilCYTTWDTPGQLEVFLERGYTFERMLADVGAGADAQRSLVMEKVF*
Ga0066659_1086330813300006797SoilLEVFLERGYTFERLLADVGSRLTPSRSLVMEKVF*
Ga0066659_1138186133300006797SoilEGAVRIHCYTTWDTPEQLEVFLERRYTFERMLVDVAEIIPEPTIVMEKVF*
Ga0066710_10177820133300009012Grasslands SoilRLHCYTTWDTPEQLEVFLERGYTFDRLLADVGLSGIERSLTMEKLF
Ga0066710_10186590933300009012Grasslands SoilDTPDQLEAFLERGYTVERMLADVAGISTQRARVMEKVF
Ga0066710_10196261813300009012Grasslands SoilTPGQLEAFLERGYTVERMLLDIANVRAETTLLMEKIF
Ga0099827_1112149613300009090Vadose Zone SoilNGDVLMHCYSTWDTPEQLDAFLERGYTPERMLADVAGIVLPRARVLEKVF*
Ga0105245_1133404713300009098Miscanthus RhizosphereHCYTTWDTPGQLEVFLERGYTFERLLADIGSGLEATRSLVMEKVF*
Ga0066709_10007608443300009137Grasslands SoilVRLNCYTTLDTPGQLEAFLERGYTVERMLLDIAGVRAETTLLMEKIF*
Ga0066709_10161157013300009137Grasslands SoilHCYTTWDTPEQLEVFLERGYTVERMLLDIVGIAPEAAYLMEKIF*
Ga0066709_10321840913300009137Grasslands SoilAVPRGPVRIHCYATWVTPEQLEVLLERGYTFARMLADVADLEAEPTRVMEKVF*
Ga0105242_1025515713300009176Miscanthus RhizosphereTTWDTPEQLEAFLERGYTFERMLADVAGLQADPTLVMEKVF*
Ga0126310_1018039313300010044Serpentine SoilEQLEVYLRRGYTFERMLIDVAEIIAEPTRLMEKVF*
Ga0126319_102009513300010147SoilAGDDSDTVVHCYTTWDTPEQLEAFLERGYTFERMLHDVAGITPQPTLVMEKIF*
Ga0134088_1031828133300010304Grasslands SoilPGQLEVFLERGYTLERLLADVGSGLSAARSLVMEKVF*
Ga0134062_1058922413300010337Grasslands SoilTVWDTPDQLEAFLERGYTVERMLADVAQVPSDQVQVMEKVF*
Ga0134066_1016336513300010364Grasslands SoilHCFTTWDTPDQLEAFLERGYTFERMLIDVAEVIAQPTIVMEKVF*
Ga0134126_1137321713300010396Terrestrial SoilKLEAFVALEDSGDFLIHCYSTWDTPEQLEAFLERGYTVERMLDSVAGISATPPRIMEKVF
Ga0134124_1135844833300010397Terrestrial SoilFVHAEAEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF*
Ga0137389_1078566913300012096Vadose Zone SoilEQLEVFLERGYTFERLLADLGVGLDVDRSLVMEKLF*
Ga0137364_1076655743300012198Vadose Zone SoilDTPEQVEAFLERGYTFERMLIDVAEVTAERTRVMEKVF*
Ga0137364_1080979433300012198Vadose Zone SoilQLDAFLERGYTLERMLADVADLTVERTRLMEKVF*
Ga0137364_1098580033300012198Vadose Zone SoilCYTTLDTLAQLEAFLERGYTFERMLADVGGDVQLERSLVMEKVF*
Ga0137365_1091039313300012201Vadose Zone SoilTWDTPGQLEVFLERGYTFERLLADIGPGLEPRRALVMEKVF*
Ga0137376_1091785713300012208Vadose Zone SoilNGDMRVHCYTVWDTPEQLEALLERGYTVERMLADVAQVPTEQVQVMEKVF*
Ga0137376_1110146613300012208Vadose Zone SoilLEAFVEANPGGDVHIHCYTTWDTPEQLEAVLERGYTFERMLLDVAEVRAEPTRLMEKVF*
Ga0150985_10596450323300012212Avena Fatua RhizosphereMHCYATWDTPEQLEAFLERGYTFERLLADLDAPAPQRTLVMEKVF*
Ga0137366_1059315613300012354Vadose Zone SoilVCYTTWDTPEQLEAFLERGYTFERMLVDVAEILAEQTRVVEKIF*
Ga0137371_1035524833300012356Vadose Zone SoilWDTPEQLEAFLERGYTVERMLLDIAGVQPETTLLVEKIF*
Ga0137371_1099200813300012356Vadose Zone SoilHCYSTWDTLDQLEAFLERGYTFERMLADTADGAVERSLVMEKLF*
Ga0137371_1144481233300012356Vadose Zone SoilCYSVWDTPEQLEAFLERGYTPERMLADVVGIRSERARVMEKVF*
Ga0137385_1151075533300012359Vadose Zone SoilGMRLSCYTTWDTPDQLEAFLERGYTFERMLHDAAGLAAEPTRVVEKIF*
Ga0137375_1067058513300012360Vadose Zone SoilTTWDTAAQLEAYLERGYTFERLLADFGERLEPERTLVMEKVF*
Ga0157304_108946033300012882SoilSTWDTPEQLEAFLERGYTLQRMLMDTAGIAVESSRVVEKVF*
Ga0137407_1011286313300012930Vadose Zone SoilTPGQLEVFLERGYTFERMLADVGSGLSAARSLVMEKVF*
Ga0162653_10004666513300012937SoilTWDTPEQLEAFLARGYTFERMLDDVASLQAEPTRLMEKVF*
Ga0164302_1167758133300012961SoilFVAPEGPDYRIHCYPTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF*
Ga0134110_1008374633300012975Grasslands SoilDNGDVLMHCYSTWDTPDQLEAFLERGYTVERMLGDVAGISTQRARVMEKVF*
Ga0134110_1040103423300012975Grasslands SoilVRIHCFTTWDTPGQLEAFLERGYTFERMLIDVAEIVAESTRVMEKVF*
Ga0134076_1018559933300012976Grasslands SoilAESEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGIAAQPTLVMEKIF*
Ga0134087_1007608333300012977Grasslands SoilWDTPEQLEAFLERGYTVERMLLDIAGVQPETTLLMEKIF*
Ga0134087_1025157313300012977Grasslands SoilHVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLTAEPTRLMEKVF*
Ga0134087_1027057213300012977Grasslands SoilPWQLEAFLERGYTFERMLADFGGLGAERSLVMHKVF*
Ga0164309_1107815713300012984SoilTPEQLEAFLERGYTFERMLADVAGLQAEPTLVMEKVF*
Ga0157378_1132801633300013297Miscanthus RhizosphereHCYTTWDTPEQLEAFLERGYTFDRMLVDVAGITAQPTLVMEKVF*
Ga0163162_1189111013300013306Switchgrass RhizospherePEQLEAFLERGYTVERMLVDVAGIAAEPTRVVEKVF*
Ga0120181_108012633300013766PermafrostCYTTWDSAGQLEVYLERGYTFERLLGDIGSGLSAARSLVMEKVF*
Ga0134081_1041458533300014150Grasslands SoilTPEQLEAFLERGYTFERMLHDAAGLQAQETHVLEKVF*
Ga0134079_1014615233300014166Grasslands SoilGGMRVHAYTTWDTPEQLEAYLERGYTFERMLADAGGITAESTRLMEKIF*
Ga0182000_1055197813300014487SoilIHCYTTWDTPEQLDAFLERGYTFERMLVDVAGIAAEPTLVMEKVF*
Ga0182001_1010006333300014488SoilEQLEVFLERGYTFERMLADVAELSVDRTYVMEKEF*
Ga0120104_107151713300014829PermafrostRVHCYTIWDTPQQLEAFLERGYTFERMLADVAGIQAEPPRLMEKIF*
Ga0137420_149220633300015054Vadose Zone SoilVQLEAFLERGYTFERMLADFGGLAAERSLVMQKVF*
Ga0134072_1030617513300015357Grasslands SoilTTWDTPEQLEGFLERGYTFERMLHDAAGLQAQETHVLEKVF*
Ga0134074_118342533300017657Grasslands SoilRVNCYTTWDTPEQLEAFLERGYTFERMLIDVAEVTAESTRVMEKVF
Ga0184610_108226933300017997Groundwater SedimentHCYTTWDTPAQLEVFLERGYTFERLLADIGEGLDIQRTLAMEKVF
Ga0184605_1008111733300018027Groundwater SedimentRLHCYTTWDTPEQLQAFLARGYTFERMLADVASLKAEPPRMMEKIF
Ga0184623_1039285713300018056Groundwater SedimentTTWDKAGQLEVFLERGYTFERLLADIGSGLSAARSLVMEKVF
Ga0184619_1027615513300018061Groundwater SedimentQLEAFLERGYTFERLIADFGGDVELERSLVMEKIF
Ga0184619_1034521013300018061Groundwater SedimentTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF
Ga0184637_1057994213300018063Groundwater SedimentPGQLEAFLERGYTFERLLADFGSLDPERSLVMEKIF
Ga0184618_1023616713300018071Groundwater SedimentIHCYTTWDTPAQLEVFLERGYTFERLLADVGSGLDAKRTLVMEKVF
Ga0066667_1081623613300018433Grasslands SoilCYTTWDTPEQLEAFLERGYTVERMLLDIAGVQPETTLLMEKIF
Ga0066669_1050682813300018482Grasslands SoilGAVRIHCYTTWDTPGQLEAFLERGYTFERMLIDVAEVIAQPTIVMEKVF
Ga0066669_1117351433300018482Grasslands SoilWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF
Ga0184644_112847813300019269Groundwater SedimentPEQLQAFLARGYTFERMLADVASLKAEPPRMMEKIF
Ga0193705_105033813300019869SoilEAFVEPAGPDYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF
Ga0193728_129201413300019890SoilWDTPEQLEVFLERGYTFERMLADAAGLGADRTYVMEKIF
Ga0193718_103218413300019999SoilGQLEVFLERGYTFERLLADIGSGLEATRSLVMEKVF
Ga0193721_114283213300020018SoilPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKIF
Ga0193721_117078733300020018SoilGQLEVFLERGYTFERMLADVGSGLSPSRSLVMEKVF
Ga0193733_111829413300020022SoilDVLVNCYTTWDTAGQLEVFLERGYTFERLLADIGSGLGPARSLVMEKVF
Ga0210381_1032036433300021078Groundwater SedimentFSIEQLEVFLDRGYTFVRMLGDVAGLETEETILMEKVF
Ga0222621_103483413300021510Groundwater SedimentHCYTTWDTIEQLEVFLARGYTFVRMLGDVAGLESEETIVMEKVF
Ga0247747_100140433300022737SoilSDYRLRCYTTWDTPEQLEAFLERGYTFERMLADVIGLEVEPPFVMEKVF
Ga0247747_102421433300022737SoilTTWDTAGQLEVFLERGYTFERLLADIGSGLGPGRSLVMEKVF
Ga0210142_100579833300025552Natural And Restored WetlandsALDENDDVNLHCYSVWDTPEQLEAFLERGYTVERMLADVAERPSERARVMEKVF
Ga0210100_100756113300025780Natural And Restored WetlandsWDSPEQLEVYVDQGYTFERMLDDVADLAVERRGVMEKIF
Ga0207664_1143925313300025929Agricultural SoilFRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGVAAEPTLVMEKVF
Ga0207706_1063809813300025933Corn RhizosphereWDTPEQLEAFLERGYTVERMLVDVAGIAAEPTRVVEKVF
Ga0207686_1059945233300025934Miscanthus RhizosphereGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF
Ga0207669_1043641013300025937Miscanthus RhizosphereWQLEAFLERGYTLERLLADFGDLSAERSLVMEKVF
Ga0209027_105452413300026300Grasslands SoilEPNGDFRVHCFTTWDTPEQLEVFLERGYTFERMLVDVAQITAQPTRVMEQIF
Ga0209472_122617933300026323SoilAVRIHCYTTWDTPDQLEAFLERGYTFERMLVDVAGITAQPTLVMEKIF
Ga0209267_126104813300026331SoilEVGGAGAVHVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLTAEPTRLMEKVF
Ga0209057_117591633300026342SoilEDNGDVLMHCYSTWDTPDQLEAFLERGYTVERMLADVAGISTQRARVMEKVF
Ga0209157_126781033300026537SoilAEGAVRIHCYTTWDTPEQLETYLERGYTFERMLVDVAGITAQPTLVMEKVF
Ga0209474_1008090713300026550SoilAEPDGAVRVHCYTTWDTQEQLEAFLERGYTFERMLRDVAEVGIERNYVMEKVF
Ga0207483_10081313300026750SoilEAEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF
Ga0207580_100355133300026829SoilVEQEGAGFRVHVYTTWDTPEQLETFLERGYTFERMLADVAGIETDPPHVMEKIF
Ga0209898_105491313300027068Groundwater SandWDTPGQVEAFLERGYTFDRLLADVGEDLESQRTLVMEKVF
Ga0209795_1009207633300027718AgaveRLYVYTTWDTPEQLEAFLERGYTFERMLADVAGLEAEPTRLLEKIF
Ga0307295_1001682013300028708SoilGRDYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF
Ga0307279_1004966813300028709SoilDTAGQLEVFLERGYTFERLLADIGSGISAARSLVMEKVF
Ga0307322_1005231513300028710SoilYRIHCYTTWDTPEQLEVFLERGYTFERMLADVGLKAEPPRMMEKIF
Ga0307322_1006794333300028710SoilPWQLEAFLERGYTLERLLADFGDTSAERSLVMEKVF
Ga0307303_1018538833300028713SoilLEAFVAPSGSDYRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPILVMEKVF
Ga0307313_1023290713300028715SoilVLVHCYTTWDTPGQLEVFLERGYTFERMLADVGSGLSAARSLVMEKVF
Ga0307307_1023754313300028718SoilWDTPEQLEAFLERGYTFERMLIDVAGITAQPTLVMEKIF
Ga0307301_1021181133300028719SoilEGADFRLHCYTTWDTPEQLQAFLARGYTFERMLADVASLKAEPPRMMEKIF
Ga0307317_1021850233300028720SoilDGDVLVHCYTTWDTAGQLEVFLERGYTFERLLADIGSGISPARSLVMEKVF
Ga0307317_1033285033300028720SoilRVHCYTVWDTPEQLEAFLERGYTFERMLADVAQIRSEPVRVMEKVF
Ga0307319_1020370133300028722SoilYTTWDTPTQLEAFLERGYTLERLLADFGGLAAERSLVMEKVF
Ga0307297_1000775333300028754SoilAFVESAGPDYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAEPPHLMEKIF
Ga0307316_1008398933300028755SoilYTTWDTPGQLEVFLERGYTFERLLADVGSGLTPSRSLVMEKVF
Ga0307316_1033616833300028755SoilCYTTWDTAGQLEVFLERGYTFERLLADIGSGLGPGRSLVMEKVF
Ga0307280_1018220013300028768SoilAPSGSDYRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPILVMEKVF
Ga0307288_1007474713300028778SoilYRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPTLVMEKVF
Ga0307288_1045345413300028778SoilEGDGDVLVQCYTTWDTAGQLEVFLERGYTLERLLADIGSGLGPVRSLVMEKVF
Ga0307288_1048280933300028778SoilYTTGDTPWQLEAFLERGYTLERLLADFGSLSAERSLVMEKVF
Ga0307288_1050182113300028778SoilWQLEAFLERGYTFERLLADFGGLSAERSLVMEKVF
Ga0307282_1014508713300028784SoilGQLEAFIERGYTFERLIGDFGGEIELERSLVMEKIF
Ga0307282_1020640913300028784SoilDCYTVWDTPEQLEAFLERGYTLERMLKGVANIDAAPARIVEKVF
Ga0307282_1036616913300028784SoilEAFDELCGSGAVRVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLPAEPTRVMEKVF
Ga0307282_1055940613300028784SoilTIEQLEVFLERGYTLGRMLDDVADLEPEETILMEKVF
Ga0307323_1036980913300028787SoilVRVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLPAEPTRVMEKVF
Ga0307305_1010736113300028807SoilEQLEAFLERGYTVVRMLDDVADLEPEETILMEKVF
Ga0307305_1017735313300028807SoilVHCYTTWDTPEQLEVFLERGYTFERMLHDVAELDVERTYVMEKVF
Ga0307305_1051274213300028807SoilQLEAFLERGYTFERLIGDFGGEIKLERSLVMEKIF
Ga0307292_1020701413300028811SoilWDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF
Ga0307310_1036969633300028824SoilNGGVRLHCYTTWDTPWQLEAFLERGYTFERMLADFGGLGAERSLVMQKVF
Ga0307312_1093380133300028828SoilDVLVHCYTTWDTAGQLEVFLERGYTFERLLADIGSGLGPARSLVMEKVF
Ga0307300_1005296533300028880SoilDYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF
Ga0307300_1011652713300028880SoilPWDTPAQLEVFLERGYTFERLLADIGEGLDIQRTLAMEKVF
Ga0307308_1002468033300028884SoilVHCYTTWDTPWQLEAFLERGYTFERMLADFGGLGAERSLVMQKVF
Ga0307304_1015020113300028885SoilYTTWDTPWQLEAFLERGYTFERLLADFGGLEPVRSLVMEKVF
Ga0247826_1003977713300030336SoilRLHCYTTWDTPEQLEAFLERGYTFERMLADVAGLQADPTLVMEKVF
Ga0308189_1002799533300031058SoilYTTWDTIEQLEAFLERGYTVVRMLDDVADLEPEETILMEKVF
Ga0308197_1034387113300031093SoilVRVHCYTTWDTQWQLEAFLERGYTFERMLADFGSLSAERSLVMQKVF
Ga0308194_1010681233300031421SoilDYRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPILVMEKVF
Ga0308194_1017502233300031421SoilWDTPEQLEAFLERGYTFERMLHDVAGITAQPTLVMEKIF
Ga0307408_10075665413300031548RhizosphereDQVEAYLERGYTFERLLADFGAGLEPERSLVMEKVF
Ga0307407_1068389833300031903RhizosphereDVLIHCYTTWDTPDQVEAFLERGYTFDRLLADVGENLESERTLLMEKVF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.