| Basic Information | |
|---|---|
| Family ID | F033892 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 44 residues |
| Representative Sequence | HCYTTWDTPEQLEAFLERGYTFERMLDDVAGVAAEPTLVMEKVF |
| Number of Associated Samples | 138 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.90 % |
| % of genes near scaffold ends (potentially truncated) | 84.09 % |
| % of genes from short scaffolds (< 2000 bps) | 81.25 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.364 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (26.704 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.068 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF00115 | COX1 | 15.34 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.36 % |
| Unclassified | root | N/A | 13.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT01BD0ZM | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11156271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300004114|Ga0062593_101372799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300004114|Ga0062593_101558720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 715 | Open in IMG/M |
| 3300004153|Ga0063455_100746389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300004153|Ga0063455_100891415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 629 | Open in IMG/M |
| 3300004156|Ga0062589_100578255 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300004479|Ga0062595_100600199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300004643|Ga0062591_100261090 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300004643|Ga0062591_101992822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300005166|Ga0066674_10271160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 801 | Open in IMG/M |
| 3300005174|Ga0066680_10049736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2459 | Open in IMG/M |
| 3300005174|Ga0066680_10655745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300005174|Ga0066680_10834695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300005179|Ga0066684_11077469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300005187|Ga0066675_10341617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1093 | Open in IMG/M |
| 3300005187|Ga0066675_10920751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 660 | Open in IMG/M |
| 3300005294|Ga0065705_11127203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300005354|Ga0070675_101256819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300005435|Ga0070714_101229793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 731 | Open in IMG/M |
| 3300005439|Ga0070711_101718976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300005444|Ga0070694_101455584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
| 3300005446|Ga0066686_10956980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 559 | Open in IMG/M |
| 3300005450|Ga0066682_10647015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300005451|Ga0066681_10446995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
| 3300005529|Ga0070741_10088739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3348 | Open in IMG/M |
| 3300005540|Ga0066697_10834822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300005545|Ga0070695_101056894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
| 3300005560|Ga0066670_10278042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300005561|Ga0066699_10146370 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300005561|Ga0066699_11169506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300005568|Ga0066703_10821960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300005569|Ga0066705_10663830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
| 3300005575|Ga0066702_10604441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300005587|Ga0066654_10295386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300005614|Ga0068856_101081483 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005615|Ga0070702_101819784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300006034|Ga0066656_10885426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300006046|Ga0066652_101738687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300006175|Ga0070712_101438766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300006755|Ga0079222_11768421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300006796|Ga0066665_10445910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1068 | Open in IMG/M |
| 3300006797|Ga0066659_10863308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 754 | Open in IMG/M |
| 3300006797|Ga0066659_11381861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300009012|Ga0066710_101778201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300009012|Ga0066710_101865909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
| 3300009012|Ga0066710_101962618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300009090|Ga0099827_11121496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300009137|Ga0066709_100076084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3976 | Open in IMG/M |
| 3300009137|Ga0066709_101611570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300009137|Ga0066709_103218409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300009176|Ga0105242_10255157 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300010147|Ga0126319_1020095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300010304|Ga0134088_10318281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 753 | Open in IMG/M |
| 3300010337|Ga0134062_10589224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300010364|Ga0134066_10163365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
| 3300010396|Ga0134126_11373217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300010397|Ga0134124_11358448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300012096|Ga0137389_10785669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300012198|Ga0137364_10766557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300012198|Ga0137364_10809794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 708 | Open in IMG/M |
| 3300012198|Ga0137364_10985800 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300012201|Ga0137365_10910393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 641 | Open in IMG/M |
| 3300012208|Ga0137376_10917857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 752 | Open in IMG/M |
| 3300012208|Ga0137376_11101466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300012212|Ga0150985_105964503 | Not Available | 765 | Open in IMG/M |
| 3300012354|Ga0137366_10593156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300012356|Ga0137371_10355248 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300012356|Ga0137371_10992008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300012356|Ga0137371_11444812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300012359|Ga0137385_11510755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300012882|Ga0157304_1089460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300012930|Ga0137407_10112863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2349 | Open in IMG/M |
| 3300012937|Ga0162653_100046665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300012961|Ga0164302_11677581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300012975|Ga0134110_10083746 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300012975|Ga0134110_10401034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300012976|Ga0134076_10185599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300012977|Ga0134087_10076083 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300012977|Ga0134087_10251573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300012977|Ga0134087_10270572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300012984|Ga0164309_11078157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300013297|Ga0157378_11328016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 761 | Open in IMG/M |
| 3300013306|Ga0163162_11891110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300014150|Ga0134081_10414585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300014166|Ga0134079_10146152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300014487|Ga0182000_10551978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300014488|Ga0182001_10100063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300014829|Ga0120104_1071517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
| 3300015054|Ga0137420_1492206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4191 | Open in IMG/M |
| 3300015357|Ga0134072_10306175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300017657|Ga0134074_1183425 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300017997|Ga0184610_1082269 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300018027|Ga0184605_10081117 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300018056|Ga0184623_10392857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300018061|Ga0184619_10276155 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300018061|Ga0184619_10345210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| 3300018063|Ga0184637_10579942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300018071|Ga0184618_10236167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300018433|Ga0066667_10816236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 795 | Open in IMG/M |
| 3300018482|Ga0066669_10506828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300018482|Ga0066669_11173514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300019269|Ga0184644_1128478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300019869|Ga0193705_1050338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300019890|Ga0193728_1292014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300020018|Ga0193721_1142832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300020018|Ga0193721_1170787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300021078|Ga0210381_10320364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300022737|Ga0247747_1001404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2402 | Open in IMG/M |
| 3300022737|Ga0247747_1024214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300025552|Ga0210142_1005798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2245 | Open in IMG/M |
| 3300025929|Ga0207664_11439253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300025933|Ga0207706_10638098 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300025934|Ga0207686_10599452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300026300|Ga0209027_1054524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1496 | Open in IMG/M |
| 3300026323|Ga0209472_1226179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300026331|Ga0209267_1261048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300026342|Ga0209057_1175916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300026537|Ga0209157_1267810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300026550|Ga0209474_10080907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2232 | Open in IMG/M |
| 3300026750|Ga0207483_100813 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300026829|Ga0207580_1003551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300027718|Ga0209795_10092076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300028708|Ga0307295_10016820 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300028710|Ga0307322_10052315 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300028710|Ga0307322_10067943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300028713|Ga0307303_10185388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 511 | Open in IMG/M |
| 3300028715|Ga0307313_10232907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300028718|Ga0307307_10237543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300028719|Ga0307301_10211811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300028720|Ga0307317_10218502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300028720|Ga0307317_10332850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300028722|Ga0307319_10203701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300028754|Ga0307297_10007753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2754 | Open in IMG/M |
| 3300028768|Ga0307280_10182200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300028778|Ga0307288_10074747 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300028784|Ga0307282_10145087 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300028784|Ga0307282_10206409 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300028784|Ga0307282_10366169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300028784|Ga0307282_10559406 | Not Available | 555 | Open in IMG/M |
| 3300028787|Ga0307323_10369809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300028807|Ga0307305_10107361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1289 | Open in IMG/M |
| 3300028807|Ga0307305_10177353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
| 3300028811|Ga0307292_10207014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 807 | Open in IMG/M |
| 3300028824|Ga0307310_10369696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
| 3300028828|Ga0307312_10933801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300028880|Ga0307300_10052965 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300028880|Ga0307300_10116527 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300028884|Ga0307308_10024680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2776 | Open in IMG/M |
| 3300030336|Ga0247826_10039777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2516 | Open in IMG/M |
| 3300031058|Ga0308189_10027995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1399 | Open in IMG/M |
| 3300031093|Ga0308197_10343871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300031421|Ga0308194_10106812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300031421|Ga0308194_10175022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 26.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.39% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.84% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.70% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.14% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.14% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.14% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.14% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.57% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.57% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.57% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.57% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.57% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.57% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.57% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.57% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.57% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025780 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026750 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes) | Environmental | Open in IMG/M |
| 3300026829 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A3-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_01138370 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | VTTWDTPEQLEAYLERGYTFDRMLIDVSEVIAEPTVVVEKIF |
| ICChiseqgaiiFebDRAFT_111562713 | 3300000363 | Soil | YTTWDTPEQLEAFLDRGYTFERMLADVGLQAEPPRLMEKIF* |
| Ga0062593_1013727993 | 3300004114 | Soil | TWDTPEQLEAFLERGYTFDRMLADVAGITAQPTLVMEKVF* |
| Ga0062593_1015587203 | 3300004114 | Soil | FVEPVGPDYRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAEILAEPTRMMEKIF* |
| Ga0063455_1007463891 | 3300004153 | Soil | GEIRLQCYATWDTPEQLEGFLERGYTLERMLADVGAPAPERTLIMEKVF* |
| Ga0063455_1008914151 | 3300004153 | Soil | WDTPEQLEAFLERGYTVERLLADVGGIHAERSIVLEKLF* |
| Ga0062589_1005782551 | 3300004156 | Soil | TAYSTWDTPEQLEAFLERGYTMQRMLMDTAGIAVESSRVVEKVF* |
| Ga0063356_1009108743 | 3300004463 | Arabidopsis Thaliana Rhizosphere | CYTTWDTAAQLEAFLERGYTFDRLLADLGPGLEPERSLVMEKVF* |
| Ga0062595_1006001991 | 3300004479 | Soil | VHCYTTWDTPDQLEVFLERGYTFERMLADAGGLEPQRSLVMEKVF* |
| Ga0062591_1002610903 | 3300004643 | Soil | TWDTLEQLEAFLERGYTFERMLVDVAEILAEPTRMMEKIF* |
| Ga0062591_1019928223 | 3300004643 | Soil | YTTWDTSWQLEAFLERGYTLERLLADFGDLSAERSLVMEKVF* |
| Ga0066674_102711603 | 3300005166 | Soil | PDGMRLECFTTWDTPEQLDAFLERGYTIERMLADVADLTVERTRLMEKVF* |
| Ga0066680_100497363 | 3300005174 | Soil | VLVHCYTTWDTPGQLEVFLERGYTFERMLADVGAGADAQRSLVMEKVF* |
| Ga0066680_106557451 | 3300005174 | Soil | VRIHCYTTWDTPEQLEAFLERGYTFERMLHDVAGITPQPTLVMEKIF* |
| Ga0066680_108346951 | 3300005174 | Soil | RGAVRIHCYTTWDTPEQLEAFLDRGYTFARMLADVAELEAEPTRVMEKVF* |
| Ga0066684_110774693 | 3300005179 | Soil | HCYTTWDTPEQLEAFLERGYTFERMLIDVAEVIAQPTIVMEKVF* |
| Ga0066675_103416171 | 3300005187 | Soil | CYTTWDTPGQLEAFLERGYTVERMLLDIAGVRAETTLLMEKIF* |
| Ga0066675_109207513 | 3300005187 | Soil | HCYTTWDTPQQLEAFLERCYTFERMLLDVANVRAEPTHLMEKIF* |
| Ga0065705_111272033 | 3300005294 | Switchgrass Rhizosphere | WDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF* |
| Ga0070675_1012568191 | 3300005354 | Miscanthus Rhizosphere | EAEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF* |
| Ga0070714_1012297933 | 3300005435 | Agricultural Soil | HCYTTWDTPEQLEAFLERGYTFERMLDDVAGVAAEPTLVMEKVF* |
| Ga0070711_1017189763 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RVHCYTTWDTPEQLEAFLERGYTFERMLRDVAELPTERTYVMEKVF* |
| Ga0070694_1014555843 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SGSDYRLHCYTTWDTPEQLEAFLERGYTFERMLADVAGLQADPTLVMEKVF* |
| Ga0066686_109569801 | 3300005446 | Soil | AEGAVRIHCYTTWDTPEQLETYLERGYTFERMLVDVAGITAQPTLVMEKVF* |
| Ga0066682_106470153 | 3300005450 | Soil | HCYTTWDTPEQLEAFLERGYTVDRMLVDIVGVEPEVTRPMEKIF* |
| Ga0066681_104469951 | 3300005451 | Soil | WDTPEQLEGFLERGYTLERMLADVGAPAPERTLIMEKVF* |
| Ga0070741_100887393 | 3300005529 | Surface Soil | AVQLEAFLERGYTFERLLADLGVPDPERNLVMEKVF* |
| Ga0066697_108348223 | 3300005540 | Soil | PGQLEVFLERGYTFERLLADVGSGLTPSRSLVMEKVF* |
| Ga0070695_1010568943 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | CYTTWDTPEQLEAFLERGYTVERMLVDVAGIAAEPTRVVEKVF* |
| Ga0066670_102780421 | 3300005560 | Soil | VRVHCYTTWDTPEQLEAFMERGYTFERMLRDVAELPIERTYVMEKVF* |
| Ga0066699_101463701 | 3300005561 | Soil | VHCYTVWDTPEQLEAYLERGYTFDRMLKGVANLSADPTRFMEKVF* |
| Ga0066699_111695061 | 3300005561 | Soil | AAGDIVRIYCFTTWDTPEQLEAFLERGYTFERMLGDVTGIRAQPVVLMEKVF* |
| Ga0066703_108219603 | 3300005568 | Soil | EGAVRIHCYTTWDTPEQLEAYLERGYTFERMLVDVAGITAQPTLVMEKIF* |
| Ga0066705_106638301 | 3300005569 | Soil | RVHCYTTWDTPEQLEAFMERGYTFERMLRDVAELPIERTYVMEKVF* |
| Ga0066702_106044411 | 3300005575 | Soil | RVHCYTTWDTPEQLEVFLERGYTFERMLADVAELTADRTYVMEKVF* |
| Ga0066654_102953863 | 3300005587 | Soil | TWDTAEQLEVFLERGYTFERMLQDVAQLGVERSDVMEKVF* |
| Ga0068856_1010814831 | 3300005614 | Corn Rhizosphere | FRIDCYTTWDTPEQLEAFLERGYTLERMLGDVCGIAVESTRVVEKVF* |
| Ga0070702_1018197841 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | TTWDTPEQLEAYLTRGYTFERMLADVADLDAEAPQVMEKIF* |
| Ga0066656_108854261 | 3300006034 | Soil | QLEAFLERGYTFERLLADIGSGLGPARSLVMEKVF* |
| Ga0066652_1017386873 | 3300006046 | Soil | HCYTVWDTPEQLEAFLERGYTVARMLADVSGVEPEETRIMEKVF* |
| Ga0070712_1014387661 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VHAEAEGAVRIHCYTTWDTPEQLEAFLERGYTFERMLHDVGGITAQPTLVMEKIF* |
| Ga0079222_117684211 | 3300006755 | Agricultural Soil | LEDSGDFLIHCYSTWDTPEQLEAFLERGYTVERMLDSVAGISATPPRIMEKVF* |
| Ga0066665_104459101 | 3300006796 | Soil | WDTQEQLEAFLERGYTFERMLRDVAELGVERNYVMEKVF* |
| Ga0066659_108060733 | 3300006797 | Soil | CYTTWDTPGQLEVFLERGYTFERMLADVGAGADAQRSLVMEKVF* |
| Ga0066659_108633081 | 3300006797 | Soil | LEVFLERGYTFERLLADVGSRLTPSRSLVMEKVF* |
| Ga0066659_113818613 | 3300006797 | Soil | EGAVRIHCYTTWDTPEQLEVFLERRYTFERMLVDVAEIIPEPTIVMEKVF* |
| Ga0066710_1017782013 | 3300009012 | Grasslands Soil | RLHCYTTWDTPEQLEVFLERGYTFDRLLADVGLSGIERSLTMEKLF |
| Ga0066710_1018659093 | 3300009012 | Grasslands Soil | DTPDQLEAFLERGYTVERMLADVAGISTQRARVMEKVF |
| Ga0066710_1019626181 | 3300009012 | Grasslands Soil | TPGQLEAFLERGYTVERMLLDIANVRAETTLLMEKIF |
| Ga0099827_111214961 | 3300009090 | Vadose Zone Soil | NGDVLMHCYSTWDTPEQLDAFLERGYTPERMLADVAGIVLPRARVLEKVF* |
| Ga0105245_113340471 | 3300009098 | Miscanthus Rhizosphere | HCYTTWDTPGQLEVFLERGYTFERLLADIGSGLEATRSLVMEKVF* |
| Ga0066709_1000760844 | 3300009137 | Grasslands Soil | VRLNCYTTLDTPGQLEAFLERGYTVERMLLDIAGVRAETTLLMEKIF* |
| Ga0066709_1016115701 | 3300009137 | Grasslands Soil | HCYTTWDTPEQLEVFLERGYTVERMLLDIVGIAPEAAYLMEKIF* |
| Ga0066709_1032184091 | 3300009137 | Grasslands Soil | AVPRGPVRIHCYATWVTPEQLEVLLERGYTFARMLADVADLEAEPTRVMEKVF* |
| Ga0105242_102551571 | 3300009176 | Miscanthus Rhizosphere | TTWDTPEQLEAFLERGYTFERMLADVAGLQADPTLVMEKVF* |
| Ga0126310_101803931 | 3300010044 | Serpentine Soil | EQLEVYLRRGYTFERMLIDVAEIIAEPTRLMEKVF* |
| Ga0126319_10200951 | 3300010147 | Soil | AGDDSDTVVHCYTTWDTPEQLEAFLERGYTFERMLHDVAGITPQPTLVMEKIF* |
| Ga0134088_103182813 | 3300010304 | Grasslands Soil | PGQLEVFLERGYTLERLLADVGSGLSAARSLVMEKVF* |
| Ga0134062_105892241 | 3300010337 | Grasslands Soil | TVWDTPDQLEAFLERGYTVERMLADVAQVPSDQVQVMEKVF* |
| Ga0134066_101633651 | 3300010364 | Grasslands Soil | HCFTTWDTPDQLEAFLERGYTFERMLIDVAEVIAQPTIVMEKVF* |
| Ga0134126_113732171 | 3300010396 | Terrestrial Soil | KLEAFVALEDSGDFLIHCYSTWDTPEQLEAFLERGYTVERMLDSVAGISATPPRIMEKVF |
| Ga0134124_113584483 | 3300010397 | Terrestrial Soil | FVHAEAEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF* |
| Ga0137389_107856691 | 3300012096 | Vadose Zone Soil | EQLEVFLERGYTFERLLADLGVGLDVDRSLVMEKLF* |
| Ga0137364_107665574 | 3300012198 | Vadose Zone Soil | DTPEQVEAFLERGYTFERMLIDVAEVTAERTRVMEKVF* |
| Ga0137364_108097943 | 3300012198 | Vadose Zone Soil | QLDAFLERGYTLERMLADVADLTVERTRLMEKVF* |
| Ga0137364_109858003 | 3300012198 | Vadose Zone Soil | CYTTLDTLAQLEAFLERGYTFERMLADVGGDVQLERSLVMEKVF* |
| Ga0137365_109103931 | 3300012201 | Vadose Zone Soil | TWDTPGQLEVFLERGYTFERLLADIGPGLEPRRALVMEKVF* |
| Ga0137376_109178571 | 3300012208 | Vadose Zone Soil | NGDMRVHCYTVWDTPEQLEALLERGYTVERMLADVAQVPTEQVQVMEKVF* |
| Ga0137376_111014661 | 3300012208 | Vadose Zone Soil | LEAFVEANPGGDVHIHCYTTWDTPEQLEAVLERGYTFERMLLDVAEVRAEPTRLMEKVF* |
| Ga0150985_1059645032 | 3300012212 | Avena Fatua Rhizosphere | MHCYATWDTPEQLEAFLERGYTFERLLADLDAPAPQRTLVMEKVF* |
| Ga0137366_105931561 | 3300012354 | Vadose Zone Soil | VCYTTWDTPEQLEAFLERGYTFERMLVDVAEILAEQTRVVEKIF* |
| Ga0137371_103552483 | 3300012356 | Vadose Zone Soil | WDTPEQLEAFLERGYTVERMLLDIAGVQPETTLLVEKIF* |
| Ga0137371_109920081 | 3300012356 | Vadose Zone Soil | HCYSTWDTLDQLEAFLERGYTFERMLADTADGAVERSLVMEKLF* |
| Ga0137371_114448123 | 3300012356 | Vadose Zone Soil | CYSVWDTPEQLEAFLERGYTPERMLADVVGIRSERARVMEKVF* |
| Ga0137385_115107553 | 3300012359 | Vadose Zone Soil | GMRLSCYTTWDTPDQLEAFLERGYTFERMLHDAAGLAAEPTRVVEKIF* |
| Ga0137375_106705851 | 3300012360 | Vadose Zone Soil | TTWDTAAQLEAYLERGYTFERLLADFGERLEPERTLVMEKVF* |
| Ga0157304_10894603 | 3300012882 | Soil | STWDTPEQLEAFLERGYTLQRMLMDTAGIAVESSRVVEKVF* |
| Ga0137407_101128631 | 3300012930 | Vadose Zone Soil | TPGQLEVFLERGYTFERMLADVGSGLSAARSLVMEKVF* |
| Ga0162653_1000466651 | 3300012937 | Soil | TWDTPEQLEAFLARGYTFERMLDDVASLQAEPTRLMEKVF* |
| Ga0164302_116775813 | 3300012961 | Soil | FVAPEGPDYRIHCYPTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF* |
| Ga0134110_100837463 | 3300012975 | Grasslands Soil | DNGDVLMHCYSTWDTPDQLEAFLERGYTVERMLGDVAGISTQRARVMEKVF* |
| Ga0134110_104010342 | 3300012975 | Grasslands Soil | VRIHCFTTWDTPGQLEAFLERGYTFERMLIDVAEIVAESTRVMEKVF* |
| Ga0134076_101855993 | 3300012976 | Grasslands Soil | AESEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGIAAQPTLVMEKIF* |
| Ga0134087_100760833 | 3300012977 | Grasslands Soil | WDTPEQLEAFLERGYTVERMLLDIAGVQPETTLLMEKIF* |
| Ga0134087_102515731 | 3300012977 | Grasslands Soil | HVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLTAEPTRLMEKVF* |
| Ga0134087_102705721 | 3300012977 | Grasslands Soil | PWQLEAFLERGYTFERMLADFGGLGAERSLVMHKVF* |
| Ga0164309_110781571 | 3300012984 | Soil | TPEQLEAFLERGYTFERMLADVAGLQAEPTLVMEKVF* |
| Ga0157378_113280163 | 3300013297 | Miscanthus Rhizosphere | HCYTTWDTPEQLEAFLERGYTFDRMLVDVAGITAQPTLVMEKVF* |
| Ga0163162_118911101 | 3300013306 | Switchgrass Rhizosphere | PEQLEAFLERGYTVERMLVDVAGIAAEPTRVVEKVF* |
| Ga0120181_10801263 | 3300013766 | Permafrost | CYTTWDSAGQLEVYLERGYTFERLLGDIGSGLSAARSLVMEKVF* |
| Ga0134081_104145853 | 3300014150 | Grasslands Soil | TPEQLEAFLERGYTFERMLHDAAGLQAQETHVLEKVF* |
| Ga0134079_101461523 | 3300014166 | Grasslands Soil | GGMRVHAYTTWDTPEQLEAYLERGYTFERMLADAGGITAESTRLMEKIF* |
| Ga0182000_105519781 | 3300014487 | Soil | IHCYTTWDTPEQLDAFLERGYTFERMLVDVAGIAAEPTLVMEKVF* |
| Ga0182001_101000633 | 3300014488 | Soil | EQLEVFLERGYTFERMLADVAELSVDRTYVMEKEF* |
| Ga0120104_10715171 | 3300014829 | Permafrost | RVHCYTIWDTPQQLEAFLERGYTFERMLADVAGIQAEPPRLMEKIF* |
| Ga0137420_14922063 | 3300015054 | Vadose Zone Soil | VQLEAFLERGYTFERMLADFGGLAAERSLVMQKVF* |
| Ga0134072_103061751 | 3300015357 | Grasslands Soil | TTWDTPEQLEGFLERGYTFERMLHDAAGLQAQETHVLEKVF* |
| Ga0134074_11834253 | 3300017657 | Grasslands Soil | RVNCYTTWDTPEQLEAFLERGYTFERMLIDVAEVTAESTRVMEKVF |
| Ga0184610_10822693 | 3300017997 | Groundwater Sediment | HCYTTWDTPAQLEVFLERGYTFERLLADIGEGLDIQRTLAMEKVF |
| Ga0184605_100811173 | 3300018027 | Groundwater Sediment | RLHCYTTWDTPEQLQAFLARGYTFERMLADVASLKAEPPRMMEKIF |
| Ga0184623_103928571 | 3300018056 | Groundwater Sediment | TTWDKAGQLEVFLERGYTFERLLADIGSGLSAARSLVMEKVF |
| Ga0184619_102761551 | 3300018061 | Groundwater Sediment | QLEAFLERGYTFERLIADFGGDVELERSLVMEKIF |
| Ga0184619_103452101 | 3300018061 | Groundwater Sediment | TPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF |
| Ga0184637_105799421 | 3300018063 | Groundwater Sediment | PGQLEAFLERGYTFERLLADFGSLDPERSLVMEKIF |
| Ga0184618_102361671 | 3300018071 | Groundwater Sediment | IHCYTTWDTPAQLEVFLERGYTFERLLADVGSGLDAKRTLVMEKVF |
| Ga0066667_108162361 | 3300018433 | Grasslands Soil | CYTTWDTPEQLEAFLERGYTVERMLLDIAGVQPETTLLMEKIF |
| Ga0066669_105068281 | 3300018482 | Grasslands Soil | GAVRIHCYTTWDTPGQLEAFLERGYTFERMLIDVAEVIAQPTIVMEKVF |
| Ga0066669_111735143 | 3300018482 | Grasslands Soil | WDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF |
| Ga0184644_11284781 | 3300019269 | Groundwater Sediment | PEQLQAFLARGYTFERMLADVASLKAEPPRMMEKIF |
| Ga0193705_10503381 | 3300019869 | Soil | EAFVEPAGPDYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF |
| Ga0193728_12920141 | 3300019890 | Soil | WDTPEQLEVFLERGYTFERMLADAAGLGADRTYVMEKIF |
| Ga0193718_10321841 | 3300019999 | Soil | GQLEVFLERGYTFERLLADIGSGLEATRSLVMEKVF |
| Ga0193721_11428321 | 3300020018 | Soil | PEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKIF |
| Ga0193721_11707873 | 3300020018 | Soil | GQLEVFLERGYTFERMLADVGSGLSPSRSLVMEKVF |
| Ga0193733_11182941 | 3300020022 | Soil | DVLVNCYTTWDTAGQLEVFLERGYTFERLLADIGSGLGPARSLVMEKVF |
| Ga0210381_103203643 | 3300021078 | Groundwater Sediment | FSIEQLEVFLDRGYTFVRMLGDVAGLETEETILMEKVF |
| Ga0222621_10348341 | 3300021510 | Groundwater Sediment | HCYTTWDTIEQLEVFLARGYTFVRMLGDVAGLESEETIVMEKVF |
| Ga0247747_10014043 | 3300022737 | Soil | SDYRLRCYTTWDTPEQLEAFLERGYTFERMLADVIGLEVEPPFVMEKVF |
| Ga0247747_10242143 | 3300022737 | Soil | TTWDTAGQLEVFLERGYTFERLLADIGSGLGPGRSLVMEKVF |
| Ga0210142_10057983 | 3300025552 | Natural And Restored Wetlands | ALDENDDVNLHCYSVWDTPEQLEAFLERGYTVERMLADVAERPSERARVMEKVF |
| Ga0210100_10075611 | 3300025780 | Natural And Restored Wetlands | WDSPEQLEVYVDQGYTFERMLDDVADLAVERRGVMEKIF |
| Ga0207664_114392531 | 3300025929 | Agricultural Soil | FRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGVAAEPTLVMEKVF |
| Ga0207706_106380981 | 3300025933 | Corn Rhizosphere | WDTPEQLEAFLERGYTVERMLVDVAGIAAEPTRVVEKVF |
| Ga0207686_105994523 | 3300025934 | Miscanthus Rhizosphere | GAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF |
| Ga0207669_104364101 | 3300025937 | Miscanthus Rhizosphere | WQLEAFLERGYTLERLLADFGDLSAERSLVMEKVF |
| Ga0209027_10545241 | 3300026300 | Grasslands Soil | EPNGDFRVHCFTTWDTPEQLEVFLERGYTFERMLVDVAQITAQPTRVMEQIF |
| Ga0209472_12261793 | 3300026323 | Soil | AVRIHCYTTWDTPDQLEAFLERGYTFERMLVDVAGITAQPTLVMEKIF |
| Ga0209267_12610481 | 3300026331 | Soil | EVGGAGAVHVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLTAEPTRLMEKVF |
| Ga0209057_11759163 | 3300026342 | Soil | EDNGDVLMHCYSTWDTPDQLEAFLERGYTVERMLADVAGISTQRARVMEKVF |
| Ga0209157_12678103 | 3300026537 | Soil | AEGAVRIHCYTTWDTPEQLETYLERGYTFERMLVDVAGITAQPTLVMEKVF |
| Ga0209474_100809071 | 3300026550 | Soil | AEPDGAVRVHCYTTWDTQEQLEAFLERGYTFERMLRDVAEVGIERNYVMEKVF |
| Ga0207483_1008131 | 3300026750 | Soil | EAEGAVRVHCYTTWDTPEQLEAFLERGYTFERMLVDVAGITAQPTLVMEKVF |
| Ga0207580_10035513 | 3300026829 | Soil | VEQEGAGFRVHVYTTWDTPEQLETFLERGYTFERMLADVAGIETDPPHVMEKIF |
| Ga0209898_10549131 | 3300027068 | Groundwater Sand | WDTPGQVEAFLERGYTFDRLLADVGEDLESQRTLVMEKVF |
| Ga0209795_100920763 | 3300027718 | Agave | RLYVYTTWDTPEQLEAFLERGYTFERMLADVAGLEAEPTRLLEKIF |
| Ga0307295_100168201 | 3300028708 | Soil | GRDYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF |
| Ga0307279_100496681 | 3300028709 | Soil | DTAGQLEVFLERGYTFERLLADIGSGISAARSLVMEKVF |
| Ga0307322_100523151 | 3300028710 | Soil | YRIHCYTTWDTPEQLEVFLERGYTFERMLADVGLKAEPPRMMEKIF |
| Ga0307322_100679433 | 3300028710 | Soil | PWQLEAFLERGYTLERLLADFGDTSAERSLVMEKVF |
| Ga0307303_101853883 | 3300028713 | Soil | LEAFVAPSGSDYRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPILVMEKVF |
| Ga0307313_102329071 | 3300028715 | Soil | VLVHCYTTWDTPGQLEVFLERGYTFERMLADVGSGLSAARSLVMEKVF |
| Ga0307307_102375431 | 3300028718 | Soil | WDTPEQLEAFLERGYTFERMLIDVAGITAQPTLVMEKIF |
| Ga0307301_102118113 | 3300028719 | Soil | EGADFRLHCYTTWDTPEQLQAFLARGYTFERMLADVASLKAEPPRMMEKIF |
| Ga0307317_102185023 | 3300028720 | Soil | DGDVLVHCYTTWDTAGQLEVFLERGYTFERLLADIGSGISPARSLVMEKVF |
| Ga0307317_103328503 | 3300028720 | Soil | RVHCYTVWDTPEQLEAFLERGYTFERMLADVAQIRSEPVRVMEKVF |
| Ga0307319_102037013 | 3300028722 | Soil | YTTWDTPTQLEAFLERGYTLERLLADFGGLAAERSLVMEKVF |
| Ga0307297_100077533 | 3300028754 | Soil | AFVESAGPDYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAEPPHLMEKIF |
| Ga0307316_100839893 | 3300028755 | Soil | YTTWDTPGQLEVFLERGYTFERLLADVGSGLTPSRSLVMEKVF |
| Ga0307316_103361683 | 3300028755 | Soil | CYTTWDTAGQLEVFLERGYTFERLLADIGSGLGPGRSLVMEKVF |
| Ga0307280_101822001 | 3300028768 | Soil | APSGSDYRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPILVMEKVF |
| Ga0307288_100747471 | 3300028778 | Soil | YRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPTLVMEKVF |
| Ga0307288_104534541 | 3300028778 | Soil | EGDGDVLVQCYTTWDTAGQLEVFLERGYTLERLLADIGSGLGPVRSLVMEKVF |
| Ga0307288_104828093 | 3300028778 | Soil | YTTGDTPWQLEAFLERGYTLERLLADFGSLSAERSLVMEKVF |
| Ga0307288_105018211 | 3300028778 | Soil | WQLEAFLERGYTFERLLADFGGLSAERSLVMEKVF |
| Ga0307282_101450871 | 3300028784 | Soil | GQLEAFIERGYTFERLIGDFGGEIELERSLVMEKIF |
| Ga0307282_102064091 | 3300028784 | Soil | DCYTVWDTPEQLEAFLERGYTLERMLKGVANIDAAPARIVEKVF |
| Ga0307282_103661691 | 3300028784 | Soil | EAFDELCGSGAVRVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLPAEPTRVMEKVF |
| Ga0307282_105594061 | 3300028784 | Soil | TIEQLEVFLERGYTLGRMLDDVADLEPEETILMEKVF |
| Ga0307323_103698091 | 3300028787 | Soil | VRVHCYTVWDTPEQLEAFLERGYTFERMLKGVANLPAEPTRVMEKVF |
| Ga0307305_101073611 | 3300028807 | Soil | EQLEAFLERGYTVVRMLDDVADLEPEETILMEKVF |
| Ga0307305_101773531 | 3300028807 | Soil | VHCYTTWDTPEQLEVFLERGYTFERMLHDVAELDVERTYVMEKVF |
| Ga0307305_105127421 | 3300028807 | Soil | QLEAFLERGYTFERLIGDFGGEIKLERSLVMEKIF |
| Ga0307292_102070141 | 3300028811 | Soil | WDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF |
| Ga0307310_103696963 | 3300028824 | Soil | NGGVRLHCYTTWDTPWQLEAFLERGYTFERMLADFGGLGAERSLVMQKVF |
| Ga0307312_109338013 | 3300028828 | Soil | DVLVHCYTTWDTAGQLEVFLERGYTFERLLADIGSGLGPARSLVMEKVF |
| Ga0307300_100529653 | 3300028880 | Soil | DYRIHCYTVWDTPEQLEAFLERGYTFERMLDDVAGIQAERPHLMEKIF |
| Ga0307300_101165271 | 3300028880 | Soil | PWDTPAQLEVFLERGYTFERLLADIGEGLDIQRTLAMEKVF |
| Ga0307308_100246803 | 3300028884 | Soil | VHCYTTWDTPWQLEAFLERGYTFERMLADFGGLGAERSLVMQKVF |
| Ga0307304_101502011 | 3300028885 | Soil | YTTWDTPWQLEAFLERGYTFERLLADFGGLEPVRSLVMEKVF |
| Ga0247826_100397771 | 3300030336 | Soil | RLHCYTTWDTPEQLEAFLERGYTFERMLADVAGLQADPTLVMEKVF |
| Ga0308189_100279953 | 3300031058 | Soil | YTTWDTIEQLEAFLERGYTVVRMLDDVADLEPEETILMEKVF |
| Ga0308197_103438711 | 3300031093 | Soil | VRVHCYTTWDTQWQLEAFLERGYTFERMLADFGSLSAERSLVMQKVF |
| Ga0308194_101068123 | 3300031421 | Soil | DYRVHCYTTWDTPEQLEAFLERGYTFERMLDDVAGLAAEPILVMEKVF |
| Ga0308194_101750223 | 3300031421 | Soil | WDTPEQLEAFLERGYTFERMLHDVAGITAQPTLVMEKIF |
| Ga0307408_1007566541 | 3300031548 | Rhizosphere | DQVEAYLERGYTFERLLADFGAGLEPERSLVMEKVF |
| Ga0307407_106838983 | 3300031903 | Rhizosphere | DVLIHCYTTWDTPDQVEAFLERGYTFDRLLADVGENLESERTLLMEKVF |
| ⦗Top⦘ |