Scaffold SL_6KL_011_BRINEDRAFT_1011220

Overview

Basic Information

• Taxon OID: 3300000361
• Scaffold ID: SL_6KL_011_BRINEDRAFT_1011220
• Source Dataset Name: Alkaline brine water microbial communities from Soda crystalizer, Kulunda Steppe, Russia - 6KL_011_BRINE
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 3715
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Haloferacales → Halorubraceae → Halorubrum → unclassified Halorubrum → Halorubrum sp. 48-1-W (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Brine Water → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location

• Location Name: Russia: Kulunda Steppe
• Coordinates
  • Lat. (^o): 51.64
  • Long. (^o): 79.73

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066493	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_6KL_011_BRINEDRAFT_10112207	F066493	GGAGG	MSQREWHDGVVDVADELVKEYSADGAIDRLQSRRQTSNEQLQARCTEAIAYIRREVMDDT