| Basic Information | |
|---|---|
| Taxon OID | 3300000359 Open in IMG/M |
| Scaffold ID | EM204_1013653 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Cork, Ireland - EM204 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI), Macrogen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 120343 |
| Total Scaffold Genes | 132 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 42 (31.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cork, Ireland | |||||||
| Coordinates | Lat. (o) | 51.907 | Long. (o) | -8.472 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099451 | Metagenome | 103 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| EM204_1013653116 | F099451 | N/A | MEIKNVGQLRKIIENLPDDFEIEMRVRRKLTDEELKNCRYPYPYDTEYLILEFDDIGVSNKVLCLGVTSNG* |
| ⦗Top⦘ |