| Basic Information | |
|---|---|
| Taxon OID | 3300000351 Open in IMG/M |
| Scaffold ID | SR_TP_S2DRAFT_1001075 Open in IMG/M |
| Source Dataset Name | Alkaline sediment microbial communities from bioreactor in Germany - Reactor TP_S2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7879 |
| Total Scaffold Genes | 21 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (90.48%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany | |||||||
| Coordinates | Lat. (o) | 53.109 | Long. (o) | 8.845 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091594 | Metagenome / Metatranscriptome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SR_TP_S2DRAFT_100107520 | F091594 | GAGG | MNEKNITHYCLGTGELKCDGCQQEKNWQTLNEMPDTWRKSAQSRAARIDSTECILTGRPWYAPAEIRQAEEN* |
| ⦗Top⦘ |