| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000351 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0063439 | Gp0054161 | Ga0026139 |
| Sample Name | Alkaline sediment microbial communities from bioreactor in Germany - Reactor TP_S2 |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 45604573 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → bioreactor → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Germany | |||||||
| Coordinates | Lat. (o) | 53.109 | Long. (o) | 8.845 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091594 | Metagenome / Metatranscriptome | 107 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SR_TP_S2DRAFT_1001075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 7879 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SR_TP_S2DRAFT_1001075 | SR_TP_S2DRAFT_100107520 | F091594 | MNEKNITHYCLGTGELKCDGCQQEKNWQTLNEMPDTWRKSAQSRAARIDSTECILTGRPWYAPAEIRQAEEN* |
| ⦗Top⦘ |