| Basic Information | |
|---|---|
| Taxon OID | 3300000345 Open in IMG/M |
| Scaffold ID | OctSS_8084CDRAFT_1007671 Open in IMG/M |
| Source Dataset Name | Hot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - T=80-84 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1295 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Octopus Spring Streamers, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.5340836 | Long. (o) | -110.7978895 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073601 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| OctSS_8084CDRAFT_10076713 | F073601 | N/A | LVGAGCPLPGVSLALGRAMLQAKATCLVMALPAKGREDQRMFGRLRFAWRCAIKIIACGNIIRALPVEQKALAGMGILRQQG* |
| ⦗Top⦘ |