NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000345

3300000345: Hot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - T=80-84



Overview

Basic Information
IMG/M Taxon OID3300000345 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0067861 | Gp0054574 | Ga0026524
Sample NameHot spring and microbial mat streamer communities from Octopus Spring Streamers, Yellowstone National Park, USA - T=80-84
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size49094763
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber1
All Organisms → cellular organisms → Bacteria1
Not Available5

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameSaline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring And Microbial Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → microbial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationOctopus Spring Streamers, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.5340836Long. (o)-110.7978895Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021443Metagenome / Metatranscriptome219Y
F043237Metagenome / Metatranscriptome156Y
F073601Metagenome / Metatranscriptome120Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
OctSS_8084CDRAFT_1007325All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Aquificaceae → Thermocrinis → Thermocrinis ruber1341Open in IMG/M
OctSS_8084CDRAFT_1007671All Organisms → cellular organisms → Bacteria1295Open in IMG/M
OctSS_8084CDRAFT_1012988Not Available877Open in IMG/M
OctSS_8084CDRAFT_1013262Not Available863Open in IMG/M
OctSS_8084CDRAFT_1014857Not Available789Open in IMG/M
OctSS_8084CDRAFT_1017629Not Available686Open in IMG/M
OctSS_8084CDRAFT_1023040Not Available549Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
OctSS_8084CDRAFT_1007325OctSS_8084CDRAFT_10073252F043237MELERTARYIAQLSSRGYKYAVVGKLARYDKKIVKKLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLASKPLEFPNAPLKLHYDEKTKRLRLLAQRSFINECLKVIERASSLKYPNHKLYTAKVNEALRNLYSILAYTYNDRERLRAIKRKVKHLFVEALKKNYGIEPKKAMEDYRRFVVKFSDVLKKKQRANSSTS*
OctSS_8084CDRAFT_1007671OctSS_8084CDRAFT_10076713F073601LVGAGCPLPGVSLALGRAMLQAKATCLVMALPAKGREDQRMFGRLRFAWRCAIKIIACGNIIRALPVEQKALAGMGILRQQG*
OctSS_8084CDRAFT_1012988OctSS_8084CDRAFT_10129882F021443MKCLLNNEKLSFIFRNTLVTCCNYGDNYYQINGILPFAVTDLAFKIIKQQKRKSIILKKRKPIVHLLNYIDILNSNFNSKKFDIDFFLKNKHKTQLIYNLYLYRNLHRTGYYENIYKDGLKVIERKNLCIIRLEDDFPSVIQPKNLNLAVMLMHILQKEEIDMLEGNGIVFYYVFLM*
OctSS_8084CDRAFT_1013262OctSS_8084CDRAFT_10132621F043237MDLEKTARYIAQLSRHGYKYAIVGKLVRYDREKVKRIEFQGFVFYLCRLPSKKEVVSYCLPRSEGPFRVYCLSSKPLEFPNAPLKLYYDEKTQRLRLLAQRSFINDCLNAIEKASEVKYPSPKLYLAHINRVLHQLYAILAHTYNDKERLRAIKRKVKHWVVEALKNQYGLRPKDAMTDYHRYVLKFSDVLRKKRQKAHKR*
OctSS_8084CDRAFT_1014857OctSS_8084CDRAFT_10148571F021443MKYLLNDEKLTFAFGFFNVTCSNYDYNCSYYQINGILPFAVINLALEIAKQQKRKSIISKKRKPIIHLLNYIDILNFNFNSHKFEITLPLRNDYNRQLTRNLYLYRRSHHRRYYEDYYGDSIKVIESKNLCIIRLEYSFASIIQPKNSSLATVLMHILEKDEIDTIDASGIIYYCVFLM*
OctSS_8084CDRAFT_1017629OctSS_8084CDRAFT_10176291F021443MKYLLNDEKLTFVFGYFYVTCNNYDYSCYQNNGILSFAVMDLALKIIKQQKRKSIILKKRKPIIHLLNYIDTLNFNNNKFDITLPSKNNYKTQLIYNLYSYRNSHLRRYYEGFYKDSLKVIERENLCIIRPEYDYASRIQPKNLSLVTMLMHILEKEEIDMIDASGIIFYCVFLM*
OctSS_8084CDRAFT_1023040OctSS_8084CDRAFT_10230401F021443MKYLLNSEKLTFVFRSSYVTCYNYGYGYYQNDGILSFAVMDLALKIIKQQKRKSIILKKRKPIIHLLNYVDTLNSNFNSNKFDIILSLKNNYKTQLIYNLYSYRNSHLRRYYEGFYEDSLKVIERENLCIIRLEYDYAYSIQPKNLNLAVMLMHILQKEEIDMMIDASGIIFY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.