Scaffold EM172_1081204

Overview

Basic Information

• Taxon OID: 3300000329
• Scaffold ID: EM172_1081204
• Source Dataset Name: Human fecal microbial communities from Cork, Ireland - EM172
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI), Macrogen
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3340
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Intestinimonas → Intestinimonas butyriciproducens (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location

• Location Name: Cork, Ireland
• Coordinates
  • Lat. (^o): 51.907
  • Long. (^o): -8.472

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029444	Metagenome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
EM172_10812043	F029444	N/A	MGVSEQLTGFELEDLMSWTVSNLQHPFREDFSLEKSGIIAEKESQIFGRRFVGFDS*