| Basic Information | |
|---|---|
| Taxon OID | 3300000303 Open in IMG/M |
| Scaffold ID | Cc92DRAFT_1025399 Open in IMG/M |
| Source Dataset Name | CECUM_9-2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University College Cork |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 718 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ireland: Cork | |||||||
| Coordinates | Lat. (o) | 51.897783 | Long. (o) | -8.470613 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011632 | Metagenome | 288 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Cc92DRAFT_10253993 | F011632 | AGG | VLI*KGGQAREWAAQRGGAVTDPGGGQRAFGCCAEGHGLARTIGEGRMVGLDDPVGLFQP |
| ⦗Top⦘ |