NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Cc41DRAFT_1027818

Scaffold Cc41DRAFT_1027818


Overview

Basic Information
Taxon OID3300000301 Open in IMG/M
Scaffold IDCc41DRAFT_1027818 Open in IMG/M
Source Dataset NameCECUM_4-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity College Cork
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)30892
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (42.55%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Birds → Digestive System → Ceca → Lumen → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland

Source Dataset Sampling Location
Location NameIreland: Cork
CoordinatesLat. (o)51.897783Long. (o)-8.470613Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013656Metagenome269Y

Sequences

Protein IDFamilyRBSSequence
Cc41DRAFT_102781816F013656AGAAGGMIKKIYKEPIKEEMETTINVLYSENKLSLYTNKVDLQKKLNKLLGEPTKEYKIKRSIVGSTWDIPLKEKDKITKIILKANIYEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.