NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Cc41DRAFT_1014650

Scaffold Cc41DRAFT_1014650


Overview

Basic Information
Taxon OID3300000301 Open in IMG/M
Scaffold IDCc41DRAFT_1014650 Open in IMG/M
Source Dataset NameCECUM_4-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity College Cork
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)791
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Birds → Digestive System → Ceca → Lumen → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland

Source Dataset Sampling Location
Location NameIreland: Cork
CoordinatesLat. (o)51.897783Long. (o)-8.470613Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006329Metagenome / Metatranscriptome376Y

Sequences

Protein IDFamilyRBSSequence
Cc41DRAFT_10146502F006329GAGLKEKLKRIEGEKMELELHVADVVDDHKIKMEKMRLKIRKIRKYAIDSEAWYHYAVGSIVTLVAILIAFVVAFKCFS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.