NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EM039_1015611

Scaffold EM039_1015611


Overview

Basic Information
Taxon OID3300000273 Open in IMG/M
Scaffold IDEM039_1015611 Open in IMG/M
Source Dataset NameHuman fecal microbial communities from Cork, Ireland - EM039
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI), Macrogen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16059
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Source Dataset Sampling Location
Location NameCork, Ireland
CoordinatesLat. (o)51.907Long. (o)-8.472Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F084124Metagenome112Y

Sequences

Protein IDFamilyRBSSequence
EM039_10156113F084124N/ALNTTAKAFARATKGNKHHFHSQRNALTMFLAFLFIMAVACFNKLSFSTQTAWLFAPDKLLYLKIFMGAAQTRNF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.