NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LM34_103917

Scaffold LM34_103917


Overview

Basic Information
Taxon OID3300000272 Open in IMG/M
Scaffold IDLM34_103917 Open in IMG/M
Source Dataset NameMarine microbial communities from hydrothermal vents at Loihi seamountain, Hawaii
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPennsylvania State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1247
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From A Deep-Sea Hydrothermal Vent At Loihi Seamount, Hawaii

Source Dataset Sampling Location
Location NameLoihi Seamount, Hawaii
CoordinatesLat. (o)18.921551Long. (o)-155.935879Alt. (m)Depth (m)1271
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083429Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
LM34_1039172F083429N/AMEQGCVNMAYSRNKGKVTYGKPFRKKGSGGKFRKGSYIKYKYQNGRRVGSVQSRK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.