3300000272: Marine microbial communities from hydrothermal vents at Loihi seamountain, Hawaii

Overview

Basic Information

• IMG/M Taxon OID: 3300000272
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0072209 | Gp0053787 | Ga0011193
• Sample Name: Marine microbial communities from hydrothermal vents at Loihi seamountain, Hawaii
• Sequencing Status: Permanent Draft
• Sequencing Center: Pennsylvania State University
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 11279045
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From A Deep-Sea Hydrothermal Vent At Loihi Seamount, Hawaii
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From A Deep-Sea Hydrothermal Vent At Loihi Seamount, Hawaii

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Loihi Seamount, Hawaii
• Coordinates
  • Lat. (^o): 18.921551
  • Long. (^o): -155.935879
  • Alt. (m): N/A
  • Depth (m): 1271

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030294	Metagenome	186	Y
F083429	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
LM34_102163	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	976
LM34_103917	Not Available	1247

Sequences

Scaffold ID	Protein ID	Family	Sequence
LM34_102163	LM34_1021632	F030294	MITPHPSITGMAAGFSLVDDLNKGDVVGQLLKGSLSGAINTLSANSQALIKTDSGRKALVQAVGIAAIGSWARKALPATKIGGSKLYFKI*
LM34_103917	LM34_1039172	F083429	MEQGCVNMAYSRNKGKVTYGKPFRKKGSGGKFRKGSYIKYKYQNGRRVGSVQSRK*