Scaffold LM34_102163

Overview

Basic Information

• Taxon OID: 3300000272
• Scaffold ID: LM34_102163
• Source Dataset Name: Marine microbial communities from hydrothermal vents at Loihi seamountain, Hawaii
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Pennsylvania State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 976
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine → Marine Microbial Communities From A Deep-Sea Hydrothermal Vent At Loihi Seamount, Hawaii

Source Dataset Sampling Location

• Location Name: Loihi Seamount, Hawaii
• Coordinates
  • Lat. (^o): 18.921551
  • Long. (^o): -155.935879
  • Depth (m): 1271

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030294	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
LM34_1021632	F030294	N/A	MITPHPSITGMAAGFSLVDDLNKGDVVGQLLKGSLSGAINTLSANSQALIKTDSGRKALVQAVGIAAIGSWARKALPATKIGGSKLYFKI*