Basic Information | |
---|---|
Taxon OID | 3300000271 Open in IMG/M |
Scaffold ID | PBR_1026391 Open in IMG/M |
Source Dataset Name | Photobioreactor incubated microbial communities from Hamburg, Germany - Sample 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Goettingen Genomics Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3589 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Microbial Enhanced Oil Recovery → Unclassified → Unclassified → Photobioreactor Incubated → Photobioreactor Incubated Microbial Communities From Hamburg, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hamburg, Germany | |||||||
Coordinates | Lat. (o) | 53.560526 | Long. (o) | 10.15 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F091422 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
PBR_10263912 | F091422 | GGTGG | MAALMWNSRTQLRSLGGERLHAKYMRGASEEMMASVRLTHAVSDDDYVAVHALATAELGPGLASLEEIKRVDSLTGASIWVIRRNDMVTGFLAPLALTEAGVAALADNTFDAANIDQKWVARLGEPLAGFYCWCYAGKDQVSRGALVLGLRTLIDKHFTDLPFFGRDSTEAGARIMRHLGFFPFDDTPHLFWRCCSLMEPVAC* |
⦗Top⦘ |