| Basic Information | |
|---|---|
| Taxon OID | 3300000250 Open in IMG/M |
| Scaffold ID | LPfeb09P261000mDRAFT_1000146 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P26 1000m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 17327 |
| Total Scaffold Genes | 19 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (31.58%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | P26, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 50.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | 1000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092698 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| LPfeb09P261000mDRAFT_10001461 | F092698 | N/A | SIIGCCRFRKNINFAVSLETKRSTLVSEGSPTSAITAVRNKYV* |
| ⦗Top⦘ |