| Basic Information | |
|---|---|
| Family ID | F092698 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 38 residues |
| Representative Sequence | RFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 95.33 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.308 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (24.299 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.654 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.92% β-sheet: 0.00% Coil/Unstructured: 81.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF02881 | SRP54_N | 58.88 |
| PF02978 | SRP_SPB | 28.04 |
| PF00886 | Ribosomal_S16 | 7.48 |
| PF12806 | Acyl-CoA_dh_C | 1.87 |
| PF01746 | tRNA_m1G_MT | 1.87 |
| PF00171 | Aldedh | 0.93 |
| PF00448 | SRP54 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0541 | Signal recognition particle GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 28.04 |
| COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 7.48 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.93 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.93 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.31 % |
| All Organisms | root | All Organisms | 18.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573028|GS313G0146KB_1112079429492 | Not Available | 922 | Open in IMG/M |
| 2236876010|none_p0267995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 562 | Open in IMG/M |
| 3300000154|SI47jul10_150mDRAFT_c1051593 | Not Available | 611 | Open in IMG/M |
| 3300000159|LPaug08P2610mDRAFT_c1009362 | Not Available | 1244 | Open in IMG/M |
| 3300000247|LPaug09P26500mDRAFT_1014855 | Not Available | 1196 | Open in IMG/M |
| 3300000250|LPfeb09P261000mDRAFT_1000146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 17327 | Open in IMG/M |
| 3300000260|LP_A_09_P20_500DRAFT_1024513 | Not Available | 841 | Open in IMG/M |
| 3300000265|LP_A_09_P04_10DRAFT_1016718 | Not Available | 1433 | Open in IMG/M |
| 3300000325|SI39nov09_100mDRAFT_1054430 | Not Available | 647 | Open in IMG/M |
| 3300001354|JGI20155J14468_10153904 | Not Available | 732 | Open in IMG/M |
| 3300002176|JGI24820J26691_1025487 | Not Available | 1323 | Open in IMG/M |
| 3300003587|JGI26256J51712_1012997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1906 | Open in IMG/M |
| 3300003596|JGI26255J51710_1006955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3094 | Open in IMG/M |
| 3300003602|JGI26262J51727_1029559 | Not Available | 1344 | Open in IMG/M |
| 3300004975|Ga0066625_1367655 | Not Available | 554 | Open in IMG/M |
| 3300005432|Ga0066845_10290967 | Not Available | 631 | Open in IMG/M |
| 3300005432|Ga0066845_10312743 | Not Available | 607 | Open in IMG/M |
| 3300005514|Ga0066866_10060944 | Not Available | 1416 | Open in IMG/M |
| 3300005522|Ga0066861_10055426 | Not Available | 1404 | Open in IMG/M |
| 3300005522|Ga0066861_10113961 | Not Available | 940 | Open in IMG/M |
| 3300005522|Ga0066861_10222372 | Not Available | 645 | Open in IMG/M |
| 3300005522|Ga0066861_10329529 | Not Available | 516 | Open in IMG/M |
| 3300005523|Ga0066865_10133382 | Not Available | 914 | Open in IMG/M |
| 3300005606|Ga0066835_10034628 | Not Available | 1453 | Open in IMG/M |
| 3300005606|Ga0066835_10143705 | Not Available | 787 | Open in IMG/M |
| 3300005934|Ga0066377_10082414 | Not Available | 948 | Open in IMG/M |
| 3300005934|Ga0066377_10256313 | Not Available | 540 | Open in IMG/M |
| 3300005971|Ga0066370_10246083 | Not Available | 632 | Open in IMG/M |
| 3300005971|Ga0066370_10288525 | Not Available | 585 | Open in IMG/M |
| 3300006024|Ga0066371_10294394 | Not Available | 509 | Open in IMG/M |
| 3300006025|Ga0075474_10030664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1894 | Open in IMG/M |
| 3300006025|Ga0075474_10120215 | Not Available | 838 | Open in IMG/M |
| 3300006027|Ga0075462_10258702 | Not Available | 514 | Open in IMG/M |
| 3300006027|Ga0075462_10262056 | Not Available | 511 | Open in IMG/M |
| 3300006076|Ga0081592_1076262 | Not Available | 1410 | Open in IMG/M |
| 3300006166|Ga0066836_10132626 | Not Available | 1459 | Open in IMG/M |
| 3300006166|Ga0066836_10150323 | Not Available | 1370 | Open in IMG/M |
| 3300006166|Ga0066836_10416348 | Not Available | 810 | Open in IMG/M |
| 3300006334|Ga0099675_1607473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 628 | Open in IMG/M |
| 3300006341|Ga0068493_10354826 | Not Available | 1354 | Open in IMG/M |
| 3300006351|Ga0099953_1474500 | Not Available | 613 | Open in IMG/M |
| 3300006351|Ga0099953_1537006 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300006401|Ga0075506_1814067 | Not Available | 690 | Open in IMG/M |
| 3300006404|Ga0075515_10038308 | Not Available | 646 | Open in IMG/M |
| 3300007113|Ga0101666_1073850 | Not Available | 632 | Open in IMG/M |
| 3300007144|Ga0101670_1011121 | Not Available | 1354 | Open in IMG/M |
| 3300007725|Ga0102951_1037239 | Not Available | 1471 | Open in IMG/M |
| 3300007954|Ga0105739_1084774 | Not Available | 715 | Open in IMG/M |
| 3300009077|Ga0115552_1098677 | Not Available | 1265 | Open in IMG/M |
| 3300009080|Ga0102815_10230971 | Not Available | 1019 | Open in IMG/M |
| 3300009104|Ga0117902_1418119 | Not Available | 1179 | Open in IMG/M |
| 3300009425|Ga0114997_10083381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1978 | Open in IMG/M |
| 3300009445|Ga0115553_1122815 | Not Available | 1085 | Open in IMG/M |
| 3300009472|Ga0115554_1060413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1687 | Open in IMG/M |
| 3300009498|Ga0115568_10465964 | Not Available | 542 | Open in IMG/M |
| 3300009593|Ga0115011_10233823 | Not Available | 1371 | Open in IMG/M |
| 3300009785|Ga0115001_10470523 | Not Available | 778 | Open in IMG/M |
| 3300009786|Ga0114999_11129757 | Not Available | 561 | Open in IMG/M |
| 3300011254|Ga0151675_1095395 | Not Available | 752 | Open in IMG/M |
| 3300012522|Ga0129326_1190228 | Not Available | 1139 | Open in IMG/M |
| 3300016726|Ga0182045_1165674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1865 | Open in IMG/M |
| 3300017717|Ga0181404_1079143 | Not Available | 813 | Open in IMG/M |
| 3300017749|Ga0181392_1234132 | Not Available | 520 | Open in IMG/M |
| 3300017760|Ga0181408_1072300 | Not Available | 907 | Open in IMG/M |
| 3300019751|Ga0194029_1008099 | Not Available | 1464 | Open in IMG/M |
| 3300019765|Ga0194024_1025997 | Not Available | 1262 | Open in IMG/M |
| 3300020276|Ga0211509_1042413 | Not Available | 1076 | Open in IMG/M |
| 3300020318|Ga0211491_1006008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1862 | Open in IMG/M |
| 3300020335|Ga0211690_1059708 | Not Available | 856 | Open in IMG/M |
| 3300020352|Ga0211505_1018553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1809 | Open in IMG/M |
| 3300020388|Ga0211678_10335946 | Not Available | 610 | Open in IMG/M |
| 3300020404|Ga0211659_10087613 | Not Available | 1444 | Open in IMG/M |
| 3300020416|Ga0211644_10230921 | Not Available | 759 | Open in IMG/M |
| 3300020438|Ga0211576_10582418 | Not Available | 559 | Open in IMG/M |
| 3300020451|Ga0211473_10355572 | Not Available | 751 | Open in IMG/M |
| 3300020454|Ga0211548_10087094 | Not Available | 1486 | Open in IMG/M |
| 3300020456|Ga0211551_10001320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 13553 | Open in IMG/M |
| 3300020472|Ga0211579_10089712 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1852 | Open in IMG/M |
| 3300020473|Ga0211625_10000511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 46058 | Open in IMG/M |
| 3300021085|Ga0206677_10113003 | Not Available | 1262 | Open in IMG/M |
| 3300021087|Ga0206683_10407377 | Not Available | 679 | Open in IMG/M |
| 3300021335|Ga0213867_1157594 | Not Available | 775 | Open in IMG/M |
| 3300021964|Ga0222719_10269625 | Not Available | 1120 | Open in IMG/M |
| 3300022925|Ga0255773_10171346 | Not Available | 1019 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10144170 | Not Available | 1101 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10302235 | Not Available | 657 | Open in IMG/M |
| 3300024230|Ga0228638_1044140 | Not Available | 1227 | Open in IMG/M |
| 3300024296|Ga0228629_1045877 | Not Available | 1183 | Open in IMG/M |
| 3300024316|Ga0228654_1023928 | Not Available | 877 | Open in IMG/M |
| 3300025452|Ga0209046_1075098 | Not Available | 626 | Open in IMG/M |
| 3300025727|Ga0209047_1110672 | Not Available | 917 | Open in IMG/M |
| 3300025767|Ga0209137_1054658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1866 | Open in IMG/M |
| 3300025810|Ga0208543_1003842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3936 | Open in IMG/M |
| 3300025876|Ga0209223_10083957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1795 | Open in IMG/M |
| 3300025876|Ga0209223_10090457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1705 | Open in IMG/M |
| 3300025897|Ga0209425_10146811 | Not Available | 1321 | Open in IMG/M |
| 3300026513|Ga0247590_1181632 | Not Available | 536 | Open in IMG/M |
| 3300027501|Ga0208948_1026527 | Not Available | 1295 | Open in IMG/M |
| 3300027830|Ga0209359_10154953 | Not Available | 1006 | Open in IMG/M |
| 3300027830|Ga0209359_10467101 | Not Available | 583 | Open in IMG/M |
| 3300027839|Ga0209403_10652123 | Not Available | 500 | Open in IMG/M |
| 3300027847|Ga0209402_10659653 | Not Available | 581 | Open in IMG/M |
| 3300028397|Ga0228639_1109117 | Not Available | 684 | Open in IMG/M |
| 3300032006|Ga0310344_10298470 | Not Available | 1377 | Open in IMG/M |
| 3300032011|Ga0315316_10166698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1831 | Open in IMG/M |
| 3300032011|Ga0315316_10877310 | Not Available | 736 | Open in IMG/M |
| 3300032360|Ga0315334_10583106 | Not Available | 963 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 24.30% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.02% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 8.41% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.48% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 5.61% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 5.61% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 4.67% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.74% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.74% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.80% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.87% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.87% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.93% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine | 0.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.93% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.93% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.93% |
| Volcanic Co2 Seep | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep | 0.93% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573028 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, CMGS313-FOS-0p8-ETM-15m | Environmental | Open in IMG/M |
| 2236876010 | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p1-Hyp-75m | Environmental | Open in IMG/M |
| 3300000154 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 150m | Environmental | Open in IMG/M |
| 3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
| 3300000247 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P26 500m | Environmental | Open in IMG/M |
| 3300000250 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P26 1000m | Environmental | Open in IMG/M |
| 3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000325 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100m | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300002176 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m | Environmental | Open in IMG/M |
| 3300003587 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA | Environmental | Open in IMG/M |
| 3300003602 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNA | Environmental | Open in IMG/M |
| 3300004975 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI054_100m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006401 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007144 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300012522 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016726 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011504BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020276 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858) | Environmental | Open in IMG/M |
| 3300020318 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556107-ERR598973) | Environmental | Open in IMG/M |
| 3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300024230 | Seawater microbial communities from Monterey Bay, California, United States - 48D | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024316 | Seawater microbial communities from Monterey Bay, California, United States - 66D | Environmental | Open in IMG/M |
| 3300025452 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_200m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025727 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026513 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027501 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_17_M020 (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300028397 | Seawater microbial communities from Monterey Bay, California, United States - 50D | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GS313G0146KB_00652120 | 2189573028 | Marine Estuarine | SIIVCSRFRKNVKFAVSLETKRSTLVSEGSPTSAITAVCNNYV |
| none_02679951 | 2236876010 | Marine Estuarine | SIIGCCGFRKNIKFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| SI47jul10_150mDRAFT_10515932 | 3300000154 | Marine | GCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| LPaug08P2610mDRAFT_10093621 | 3300000159 | Marine | PRFRKNINFAVSLETKRSTLVSEASPTSVITAVRNKYV* |
| LPaug09P26500mDRAFT_10148551 | 3300000247 | Marine | FRKNVKFAVSLETKRSTLVSEGSPTSAMTAVCNNYV* |
| LPfeb09P261000mDRAFT_10001461 | 3300000250 | Marine | SIIGCCRFRKNINFAVSLETKRSTLVSEGSPTSAITAVRNKYV* |
| LP_A_09_P20_500DRAFT_10245132 | 3300000260 | Marine | SRFRKNVKFAVSLETKRSTLVSEGSPTSAMTAVCNNYV* |
| LP_A_09_P04_10DRAFT_10167181 | 3300000265 | Marine | RFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV* |
| SI39nov09_100mDRAFT_10544302 | 3300000325 | Marine | KNINFAVSLETKRSTLVSEASPTSAITAVRNNYV* |
| JGI20155J14468_101539041 | 3300001354 | Pelagic Marine | FRFHKNVKFVVSLETKRSTLVSDIRPLVQTAVRNKYV* |
| JGI24820J26691_10254871 | 3300002176 | Marine | VCGSFRKNVKFAVSLETKRSTLVSEGSPTSAVTAV* |
| JGI26256J51712_10129971 | 3300003587 | Marine | CCGFRKNIKFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| JGI26255J51710_10069551 | 3300003596 | Marine | SIIGCCGFRKNIKFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| JGI26262J51727_10295592 | 3300003602 | Marine | IIGCCGFRKNIKFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0066625_13676551 | 3300004975 | Marine | SIIVCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0066845_102909671 | 3300005432 | Marine | TSIIVCGSFRKNVKFAVSLETKRSTLVSEGSPTSAITAV* |
| Ga0066845_103127432 | 3300005432 | Marine | TSIIVCASFRKNVKFAVSLETKRSTLVSEGSPTSAITNA* |
| Ga0066866_100609442 | 3300005514 | Marine | RFRKNINFAVSLETKRSTLVSEGSPTSEVTAMRNKYV* |
| Ga0066861_100554261 | 3300005522 | Marine | IVCGGFRKNVKFAVSLETKRSTLVSEGSPTSAITAVCDNYV* |
| Ga0066861_101139611 | 3300005522 | Marine | RKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0066861_102223722 | 3300005522 | Marine | FRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0066861_103295292 | 3300005522 | Marine | SFRKNVKFAVSLETKRSTLVSEGSPTSAITAVCNKYV* |
| Ga0066865_101333822 | 3300005523 | Marine | IVCGSFRKNVKFAVSLETKRSTLVSEGSPTSAITAVCNNYV* |
| Ga0066835_100346282 | 3300005606 | Marine | IVCGSFRKNVKFAVSLETKRSTLVSEGSPTSAITAGCNNYV* |
| Ga0066835_101437052 | 3300005606 | Marine | FRKNIKFAVSLETKRSTLVSEGSPTSAIAAVCNKYV* |
| Ga0066377_100824142 | 3300005934 | Marine | RKNVKFAVSLETKRSTLVSEGSPTSAITIACNKYV* |
| Ga0066377_102563131 | 3300005934 | Marine | FRKNVKFAVSLETKRSTLVSEGSPTSAITAVCNNYV* |
| Ga0066370_102460832 | 3300005971 | Marine | TSIIVCASFRKNVKFAVSLETKRSTLVSEGSPTSAIINA* |
| Ga0066370_102885252 | 3300005971 | Marine | KNVKFAVSLETKRSTLVSEGSPTSAITAVCNKYV* |
| Ga0066371_102943941 | 3300006024 | Marine | IIVCGSFRKNVKFAVSLETKRSTLVSEGSPTSAITAVCNNYV* |
| Ga0075474_100306643 | 3300006025 | Aqueous | IIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV* |
| Ga0075474_101202152 | 3300006025 | Aqueous | IIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0075462_102587021 | 3300006027 | Aqueous | SFRKNVKFAVSLETKRSTLVSEGSPTSAITIACNKYV* |
| Ga0075462_102620562 | 3300006027 | Aqueous | FRKNIKFAVSLETKRSTLVSEGSPTSEITAVCNKYV* |
| Ga0081592_10762621 | 3300006076 | Diffuse Hydrothermal Fluids | SRFRKNVKFAVSLETKRSTLVSEGSPTSAVTAVCNNYV* |
| Ga0066836_101326261 | 3300006166 | Marine | GSFRKNVKFAVSLETKRSTLVSEGSPTSAITAVCNKYV* |
| Ga0066836_101503231 | 3300006166 | Marine | KNINFAVSLETKRSTLVSEGSPTSAIIAVCNKYV* |
| Ga0066836_104163482 | 3300006166 | Marine | ARFRKNIKFAVSLETKRSTLVSEGSPTSAITVVCNNYV* |
| Ga0099675_16074731 | 3300006334 | Marine | RKSVKFAVSLETKRSTLVSEGSPTSAITAVCNKYV* |
| Ga0068493_103548261 | 3300006341 | Marine | WSRFRKNVKFAVSLETKRSTLVSEGSPTSAVTAVCNNYV* |
| Ga0099953_14745002 | 3300006351 | Marine | SFRKNIKFAVSLETKRSTLVSEGSPTSAITAVCNKYV* |
| Ga0099953_15370063 | 3300006351 | Marine | CGSFRKNIKFAVSLETKRSTLVSEGSPTSAVTAVCNKYV* |
| Ga0075506_18140672 | 3300006401 | Aqueous | FRKNVKFAVSLETKRSTLVSEGSPTSEITAVRNKYV* |
| Ga0075515_100383081 | 3300006404 | Aqueous | RFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0101666_10738502 | 3300007113 | Volcanic Co2 Seep Seawater | SFRKNVKFAVSLETKRSTLVSEGSPTSAITAVRYKYV* |
| Ga0101670_10111211 | 3300007144 | Volcanic Co2 Seep | SFRKNVKFAVSLETKRSTLVSEGSPTSAITAVRNKYV* |
| Ga0102951_10372391 | 3300007725 | Water | RFRKNVKFAVSLETKRSTLVSEGSPTSAVTAVRNKYV* |
| Ga0105739_10847741 | 3300007954 | Estuary Water | RFRKNINFAVSLETKRSTLVSEASPTSEITAVRNNYV* |
| Ga0115552_10986772 | 3300009077 | Pelagic Marine | SIIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0102815_102309711 | 3300009080 | Estuarine | SIIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV* |
| Ga0117902_14181191 | 3300009104 | Marine | CCRFRKKQQFAVPLETKGSTLVSEGSPTSALVAG* |
| Ga0114997_100833813 | 3300009425 | Marine | RFRKNVKFAVSLETKRSTLVSEGSPTSAITAVRNNYV* |
| Ga0115553_11228152 | 3300009445 | Pelagic Marine | KNVKFAVSLETKRSTLVSEGSPTSAITAVRNKYV* |
| Ga0115554_10604131 | 3300009472 | Pelagic Marine | GFRKNVKFAVSLETKRSTLVSEGSPTSAITAVWNKYV* |
| Ga0115568_104659641 | 3300009498 | Pelagic Marine | FRKNIKFAVSLETKRSTLVSEASPTSAIIAVCDNYV* |
| Ga0115011_102338231 | 3300009593 | Marine | KNINFAVSLETKRSTLVSEASPTSAITAVRNKYV* |
| Ga0115001_104705231 | 3300009785 | Marine | FRKNINFAVSLETKRSTLVSEASPTSAITAVHNKYV* |
| Ga0114999_111297572 | 3300009786 | Marine | FHKNVKFVVSLETKRSALVSEGSPTSVVTAVRNKYV* |
| Ga0151675_10953951 | 3300011254 | Marine | GCGRFRKNVKFAVSWETKRSTLVSEASPTSAITAGRNKNV* |
| Ga0129326_11902281 | 3300012522 | Aqueous | KNVKFAVSLETKRSTLVSEGSPTSAVTAVRNKYV* |
| Ga0182045_11656741 | 3300016726 | Salt Marsh | RKNVKFAVSLETKRSTLVSEGSPTSAVTAVRNKYV |
| Ga0181404_10791431 | 3300017717 | Seawater | TSIIVCGSFRKNVKFAVSLETKRSTLVSEGSPTSEITAVCNKYV |
| Ga0181392_12341321 | 3300017749 | Seawater | IGCPRFRKNINFAVSLETKRSTLVSEGSPTSEIIAACNKYV |
| Ga0181408_10723001 | 3300017760 | Seawater | RFRKNINFAVSLETKRSTLVSEASPTSEITAVRNNYV |
| Ga0194029_10080991 | 3300019751 | Freshwater | SIIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0194024_10259971 | 3300019765 | Freshwater | FRKNVKFAVSLETKRSTLVSEGSPTSEVTAVRNKYV |
| Ga0211509_10424131 | 3300020276 | Marine | RKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| Ga0211491_10060081 | 3300020318 | Marine | RFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| Ga0211690_10597081 | 3300020335 | Marine | RKNINFAVSLETKRSTLVSEASPTSVITAVRNKYV |
| Ga0211505_10185531 | 3300020352 | Marine | RFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0211678_103359462 | 3300020388 | Marine | RKNVKFAVSLETKRSTLVSEGSPTSEITAVCNKYV |
| Ga0211659_100876132 | 3300020404 | Marine | GCCRFRKNINFAVSLETKRSTLVSEASPTSAVTAVRNKYV |
| Ga0211644_102309212 | 3300020416 | Marine | RKNVKFAVSLETKRSTLVSEGSPTSEITAVCNNYV |
| Ga0211576_105824181 | 3300020438 | Marine | RKNINFAVSLETKRSTLVSEASPTSEITAVRNKYV |
| Ga0211473_103555721 | 3300020451 | Marine | GCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVQKYV |
| Ga0211548_100870941 | 3300020454 | Marine | GCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0211551_100013201 | 3300020456 | Marine | RKNVKFAVSLETKRSTLVSEGSPTSEVTAVCNKNV |
| Ga0211579_100897123 | 3300020472 | Marine | GCCRFRKNINFAVSLATKRSTLVSEASPTSAITAVRYKYV |
| Ga0211625_1000051146 | 3300020473 | Marine | RKNVKFAVSLETKRSTLVSEGSPTSEKTAVRNKYV |
| Ga0206677_101130031 | 3300021085 | Seawater | IGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0206683_104073771 | 3300021087 | Seawater | GCPRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0213867_11575941 | 3300021335 | Seawater | RKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0222719_102696251 | 3300021964 | Estuarine Water | TSIIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0255773_101713461 | 3300022925 | Salt Marsh | FRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| (restricted) Ga0233433_101441701 | 3300022931 | Seawater | SIIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVCNKYV |
| (restricted) Ga0233433_103022351 | 3300022931 | Seawater | PRFRKNINFAVSLETKRSTLVSEASPTSEITAVRNNYV |
| Ga0228638_10441401 | 3300024230 | Seawater | SIIGCPRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0228629_10458772 | 3300024296 | Seawater | SIIVCGSFRKNVKFAVSLETKRSTLVSEGSPTSEITAVCNKYV |
| Ga0228654_10239281 | 3300024316 | Seawater | TSIIGCRRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| Ga0209046_10750981 | 3300025452 | Marine | GCCRFRKNINFAVSLETKRSTLVSEGSPTSAITAVRNKYV |
| Ga0209047_11106721 | 3300025727 | Marine | RFRKNINFAVSLETKRSTLVSEASPTSAITAVCNKYV |
| Ga0209137_10546581 | 3300025767 | Marine | RKNINFAVSLETKRSTLVSEASPTSAITAVRNKYVXKFNN |
| Ga0208543_10038421 | 3300025810 | Aqueous | TSIIGCCRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| Ga0209223_100839571 | 3300025876 | Pelagic Marine | FRKNINFAVSLETKRSTLVSEASPTSEITAVRNKYVXKFNK |
| Ga0209223_100904573 | 3300025876 | Pelagic Marine | RFRKNVKFAVSLETKRSTLVSEGSPTSAITAVRNKYV |
| Ga0209425_101468111 | 3300025897 | Pelagic Marine | FRKNINFAVSLETKRSTLVSEASPTSAITAVRNNYV |
| Ga0247590_11816321 | 3300026513 | Seawater | NVKFAVSLETKRSTLVSEGSPTSVITAVXNKNVXKFDK |
| Ga0208948_10265271 | 3300027501 | Marine | IGCCRFRKNINFAVSLETKRSTLVSEGSPTSGITAVRNKYV |
| Ga0209359_101549532 | 3300027830 | Marine | IIVCGSFRKNVKFAVSLETKRSTLVSEGSPTSEITAVRNKYV |
| Ga0209359_104671011 | 3300027830 | Marine | TSIIGCWRFRKNINFAVSLETKRSTLVSEASPTSAITAVQKYV |
| Ga0209403_106521231 | 3300027839 | Marine | RFRKNVKFAVSLETKRSTLVSEGSPTSAITAVRNNYV |
| Ga0209402_106596531 | 3300027847 | Marine | FHKNVKFVVSLETKRSALVSEGSPTSVVTAVRNKYV |
| Ga0228639_11091171 | 3300028397 | Seawater | IGCRRFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYV |
| Ga0310344_102984701 | 3300032006 | Seawater | IIVCASFRKNVKFAVSLETKRSTLVSEGSPTSAITVVRNKYV |
| Ga0315316_101666981 | 3300032011 | Seawater | RFRKNINFAVSLETKRSTLVSEASPTSAITAVRNKYVXKFNK |
| Ga0315316_108773101 | 3300032011 | Seawater | FRKNINFAVSLATKRSTLVSEASPTSAITAVRYKYV |
| Ga0315334_105831061 | 3300032360 | Seawater | RKNIKFAVSLETKRSTLVSEGSPTSAITAVRNKYV |
| ⦗Top⦘ |