Basic Information | |
---|---|
Taxon OID | 3300000231 Open in IMG/M |
Scaffold ID | TB_LI09_4DRAFT_10107490 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1006 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lago Infinito, wall in 6.8 m depth, Frasassi Caves, Italy | |||||||
Coordinates | Lat. (o) | 43.383333 | Long. (o) | 12.95 | Alt. (m) | Depth (m) | 6.8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F038735 | Metagenome / Metatranscriptome | 165 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TB_LI09_4DRAFT_101074902 | F038735 | AGG | MKALRWFVDSMLGYWILLLVICLGVAAGIYEIWLKGRI* |
⦗Top⦘ |