Scaffold TB_LI09_3DRAFT_1020794

Overview

Basic Information

• Taxon OID: 3300000229
• Scaffold ID: TB_LI09_3DRAFT_1020794
• Source Dataset Name: Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1726
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy

Source Dataset Sampling Location

• Location Name: Lago Infinito, wall in 7.1 m depth, Frasassi Caves, Italy
• Coordinates
  • Lat. (^o): 43.383333
  • Long. (^o): 12.95
  • Depth (m): 7.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052326	Metagenome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
TB_LI09_3DRAFT_10207942	F052326	GGA	VPRRDALVGKTEEGSELSTDVWQARIDLCVDKESKTYWIMLRLRSDSGDEKKHMSILVPKTALSEALQRASDFEKKGFHEKAEEPPDLPEAEND*