| Basic Information | |
|---|---|
| Taxon OID | 3300000227 Open in IMG/M |
| Scaffold ID | TB_AS07_7DRAFT_10076290 Open in IMG/M |
| Source Dataset Name | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- AS07_7 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 664 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater → Groundwater Microbial Communities From Subsurface Biofilms In Sulfidic Aquifier In Frasassi Gorge, Italy |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Acquasanta Terme, Italy | |||||||
| Coordinates | Lat. (o) | 42.766667 | Long. (o) | 13.4 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053659 | Metagenome / Metatranscriptome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TB_AS07_7DRAFT_100762901 | F053659 | AGGAG | MPSVAETKPNRQNRTVTLHLGNTLAEYQAMISTEEGIQELIGRVEIADSLNWGPLADGHRVDCPRCLQFTHHDAYLRWAHHFDGTRSPVTIVRVRCLECGAVFSIQPSFIVRYKRYDTDAIEKAMTLLFIAEGSYRMVNVSQALGIDTRHAGTWLALEEAEPMAISPMALWSLVQWLG |
| ⦗Top⦘ |