Scaffold LPjun09P410mDRAFT_1015714

Overview

Basic Information

• Taxon OID: 3300000223
• Scaffold ID: LPjun09P410mDRAFT_1015714
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P4 10m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 641
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P4, Pacific Ocean
• Coordinates
  • Lat. (^o): 48.65
  • Long. (^o): -126.666667
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092361	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
LPjun09P410mDRAFT_10157141	F092361	N/A	QVARENINYLDILFNKNKNINKNKILKNFKKSTILEKKFWQCFI*