Scaffold LPfeb10P161000mDRAFT_c1005586

Overview

Basic Information

• Taxon OID: 3300000219
• Scaffold ID: LPfeb10P161000mDRAFT_c1005586
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 1000m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2775
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: P16, Pacific Ocean
• Coordinates
  • Lat. (^o): 49.283333
  • Long. (^o): -134.666667
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089037	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
LPfeb10P161000mDRAFT_10055865	F089037	N/A	MSDMKSKIISNLISNNPWTYQEFWDALPDVVXSXDIKTKPIWRDDPNWPKYIKDKNK*