Scaffold SI47jul10_120mDRAFT_c1008293

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SI47jul10_120mDRAFT_c1008293

Scaffold SI47jul10_120mDRAFT_c1008293

Overview

Basic Information
Taxon OID	3300000212 Open in IMG/M
Scaffold ID	SI47jul10_120mDRAFT_c1008293 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 120m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	3091
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	Saanich Inlet 47, Vancouver Island, BC, Canada
Coordinates	Lat. (^o)	48.6	Long. (^o)	-123.5	Alt. (m)		Depth (m)	120
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093905	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
SI47jul10_120mDRAFT_100829310	F093905	N/A	MKHIPKKEFNRFYTIMKNNPGKSVLEIHNLYKKENEQIEKDMLNTAIALEANNLIPKELITNKIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.