| Basic Information | |
|---|---|
| Taxon OID | 3300000208 Open in IMG/M |
| Scaffold ID | NICFPass4AFXDRAFT_c001079 Open in IMG/M |
| Source Dataset Name | Feedstock adapted compost microbial communities from Newby Island compost facility, Milpitas, CA, USA - Passage 4_AFX |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 18793 |
| Total Scaffold Genes | 22 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (86.36%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Feedstock Adapted Compost Microbial Communities From Newby Island Compost Facility, Milpitas Ca |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Newby Island compost facility, Milpitas, CA | |||||||
| Coordinates | Lat. (o) | 37.454581 | Long. (o) | -121.928712 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036417 | Metagenome / Metatranscriptome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| NICFPass4AFXDRAFT_00107918 | F036417 | AGG | LPRRRGFAICFRAMVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR |
| ⦗Top⦘ |