Scaffold NODE_c0687657

Overview

Basic Information

• Taxon OID: 3300000156
• Scaffold ID: NODE_c0687657
• Source Dataset Name: Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Ambry Genetics
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3309
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor → Sugar Cane Bagasse Incubating Bioreactor Microbial Communities From Sao Carlos, Brazil, That Are Aerobic And Semianaerobic

Source Dataset Sampling Location

• Location Name: Sao Carlos, Brazil
• Coordinates
  • Lat. (^o): -22.080556
  • Long. (^o): -48.997778

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058984	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
NODE_06876574	F058984	AGGAG	MTTLPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQQQAAAAHKRFPLAAW*