| Basic Information | |
|---|---|
| Family ID | F058984 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 134 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRFPFAEW |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 134 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 79.85 % |
| % of genes near scaffold ends (potentially truncated) | 26.87 % |
| % of genes from short scaffolds (< 2000 bps) | 88.06 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.433 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.702 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.343 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.507 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.74% β-sheet: 0.00% Coil/Unstructured: 60.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 134 Family Scaffolds |
|---|---|---|
| PF07045 | DUF1330 | 50.00 |
| PF13577 | SnoaL_4 | 9.70 |
| PF01464 | SLT | 5.97 |
| PF07883 | Cupin_2 | 0.75 |
| PF08857 | ParBc_2 | 0.75 |
| PF04909 | Amidohydro_2 | 0.75 |
| PF00950 | ABC-3 | 0.75 |
| PF02515 | CoA_transf_3 | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
|---|---|---|---|
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 50.00 |
| COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.75 |
| COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.75 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.75 |
| COG4318 | Uncharacterized conserved protein | Function unknown [S] | 0.75 |
| COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.43 % |
| Unclassified | root | N/A | 36.57 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_1168976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1077 | Open in IMG/M |
| 2209111006|2214834100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1772 | Open in IMG/M |
| 3300000041|ARcpr5oldR_c000380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6214 | Open in IMG/M |
| 3300000156|NODE_c0687657 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
| 3300000890|JGI11643J12802_11375925 | Not Available | 527 | Open in IMG/M |
| 3300000955|JGI1027J12803_107528506 | Not Available | 1398 | Open in IMG/M |
| 3300003324|soilH2_10266620 | Not Available | 1365 | Open in IMG/M |
| 3300003994|Ga0055435_10200867 | Not Available | 574 | Open in IMG/M |
| 3300004062|Ga0055500_10057450 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300004114|Ga0062593_100278956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1406 | Open in IMG/M |
| 3300004114|Ga0062593_100305431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1359 | Open in IMG/M |
| 3300004114|Ga0062593_100899425 | Not Available | 895 | Open in IMG/M |
| 3300004114|Ga0062593_101037002 | Not Available | 845 | Open in IMG/M |
| 3300004156|Ga0062589_100235198 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300004156|Ga0062589_100249469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1329 | Open in IMG/M |
| 3300004156|Ga0062589_101147539 | Not Available | 739 | Open in IMG/M |
| 3300004463|Ga0063356_106193324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 513 | Open in IMG/M |
| 3300004479|Ga0062595_100417073 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300004479|Ga0062595_101763024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300005159|Ga0066808_1008243 | Not Available | 904 | Open in IMG/M |
| 3300005168|Ga0066809_10059963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300005277|Ga0065716_1002346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1899 | Open in IMG/M |
| 3300005328|Ga0070676_10383670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300005332|Ga0066388_100295750 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2263 | Open in IMG/M |
| 3300005332|Ga0066388_102483695 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300005332|Ga0066388_104138592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 740 | Open in IMG/M |
| 3300005336|Ga0070680_100262377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1461 | Open in IMG/M |
| 3300005339|Ga0070660_100044005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3412 | Open in IMG/M |
| 3300005366|Ga0070659_101091689 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300005434|Ga0070709_10221173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1350 | Open in IMG/M |
| 3300005438|Ga0070701_10226744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1117 | Open in IMG/M |
| 3300005440|Ga0070705_100176687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1442 | Open in IMG/M |
| 3300005455|Ga0070663_100831562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 793 | Open in IMG/M |
| 3300005458|Ga0070681_10583404 | Not Available | 1032 | Open in IMG/M |
| 3300005458|Ga0070681_10907438 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005468|Ga0070707_100494480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 1185 | Open in IMG/M |
| 3300005529|Ga0070741_10001212 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 81295 | Open in IMG/M |
| 3300005544|Ga0070686_101091641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300005547|Ga0070693_101215692 | Not Available | 579 | Open in IMG/M |
| 3300005615|Ga0070702_100514570 | Not Available | 881 | Open in IMG/M |
| 3300005616|Ga0068852_100213544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1831 | Open in IMG/M |
| 3300005713|Ga0066905_101330604 | Not Available | 647 | Open in IMG/M |
| 3300005713|Ga0066905_101816972 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005713|Ga0066905_101932494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 546 | Open in IMG/M |
| 3300005719|Ga0068861_101070445 | Not Available | 773 | Open in IMG/M |
| 3300005764|Ga0066903_103778396 | Not Available | 814 | Open in IMG/M |
| 3300005841|Ga0068863_100426105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1300 | Open in IMG/M |
| 3300005937|Ga0081455_10027927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5162 | Open in IMG/M |
| 3300006574|Ga0074056_11521625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 770 | Open in IMG/M |
| 3300006575|Ga0074053_10006847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 925 | Open in IMG/M |
| 3300006806|Ga0079220_10116088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1418 | Open in IMG/M |
| 3300006806|Ga0079220_10838549 | Not Available | 702 | Open in IMG/M |
| 3300006806|Ga0079220_11045764 | Not Available | 654 | Open in IMG/M |
| 3300006854|Ga0075425_100167949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2519 | Open in IMG/M |
| 3300006881|Ga0068865_100042081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3113 | Open in IMG/M |
| 3300006904|Ga0075424_102840095 | Not Available | 504 | Open in IMG/M |
| 3300006914|Ga0075436_100689621 | Not Available | 756 | Open in IMG/M |
| 3300009036|Ga0105244_10525632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 545 | Open in IMG/M |
| 3300009094|Ga0111539_10051313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 4913 | Open in IMG/M |
| 3300009098|Ga0105245_10726595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300009148|Ga0105243_11470904 | Not Available | 704 | Open in IMG/M |
| 3300009148|Ga0105243_11973792 | Not Available | 617 | Open in IMG/M |
| 3300009162|Ga0075423_10593366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1167 | Open in IMG/M |
| 3300009174|Ga0105241_10751868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 894 | Open in IMG/M |
| 3300009545|Ga0105237_10076507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 3337 | Open in IMG/M |
| 3300010046|Ga0126384_10869982 | Not Available | 812 | Open in IMG/M |
| 3300010047|Ga0126382_12241919 | Not Available | 526 | Open in IMG/M |
| 3300010359|Ga0126376_10186849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1703 | Open in IMG/M |
| 3300010359|Ga0126376_10972646 | Not Available | 846 | Open in IMG/M |
| 3300010359|Ga0126376_11380400 | Not Available | 728 | Open in IMG/M |
| 3300010359|Ga0126376_12082642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 611 | Open in IMG/M |
| 3300010362|Ga0126377_10245264 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1741 | Open in IMG/M |
| 3300010371|Ga0134125_10654900 | Not Available | 1159 | Open in IMG/M |
| 3300010371|Ga0134125_10670349 | Not Available | 1144 | Open in IMG/M |
| 3300010396|Ga0134126_10306692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1862 | Open in IMG/M |
| 3300010400|Ga0134122_12048039 | Not Available | 612 | Open in IMG/M |
| 3300010403|Ga0134123_13634696 | Not Available | 500 | Open in IMG/M |
| 3300012485|Ga0157325_1037536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 514 | Open in IMG/M |
| 3300012513|Ga0157326_1012754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 962 | Open in IMG/M |
| 3300012893|Ga0157284_10136246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 682 | Open in IMG/M |
| 3300012943|Ga0164241_10688673 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012957|Ga0164303_10156464 | Not Available | 1213 | Open in IMG/M |
| 3300012957|Ga0164303_10456320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 806 | Open in IMG/M |
| 3300012985|Ga0164308_11147366 | Not Available | 699 | Open in IMG/M |
| 3300012987|Ga0164307_10799886 | Not Available | 749 | Open in IMG/M |
| 3300013102|Ga0157371_11231730 | Not Available | 577 | Open in IMG/M |
| 3300013296|Ga0157374_10688688 | Not Available | 1035 | Open in IMG/M |
| 3300013306|Ga0163162_13179586 | Not Available | 527 | Open in IMG/M |
| 3300014318|Ga0075351_1052068 | Not Available | 763 | Open in IMG/M |
| 3300014497|Ga0182008_10258747 | Not Available | 900 | Open in IMG/M |
| 3300015077|Ga0173483_10830073 | Not Available | 537 | Open in IMG/M |
| 3300015371|Ga0132258_10690882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 2568 | Open in IMG/M |
| 3300015371|Ga0132258_11427218 | Not Available | 1749 | Open in IMG/M |
| 3300015372|Ga0132256_100100739 | All Organisms → cellular organisms → Bacteria | 2812 | Open in IMG/M |
| 3300015373|Ga0132257_100936026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300015374|Ga0132255_100373972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2069 | Open in IMG/M |
| 3300015374|Ga0132255_102656215 | Not Available | 765 | Open in IMG/M |
| 3300017792|Ga0163161_10816968 | Not Available | 784 | Open in IMG/M |
| 3300017930|Ga0187825_10178600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 758 | Open in IMG/M |
| 3300017930|Ga0187825_10335916 | Not Available | 569 | Open in IMG/M |
| 3300019361|Ga0173482_10001295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4997 | Open in IMG/M |
| 3300021445|Ga0182009_10615428 | Not Available | 582 | Open in IMG/M |
| 3300024055|Ga0247794_10273719 | Not Available | 563 | Open in IMG/M |
| 3300025271|Ga0207666_1003306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1977 | Open in IMG/M |
| 3300025538|Ga0210132_1004665 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1756 | Open in IMG/M |
| 3300025900|Ga0207710_10074060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1567 | Open in IMG/M |
| 3300025901|Ga0207688_10257746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1058 | Open in IMG/M |
| 3300025914|Ga0207671_11084354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 629 | Open in IMG/M |
| 3300025932|Ga0207690_11247798 | Not Available | 621 | Open in IMG/M |
| 3300025945|Ga0207679_10302230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1380 | Open in IMG/M |
| 3300025945|Ga0207679_11082168 | Not Available | 735 | Open in IMG/M |
| 3300025972|Ga0207668_11872942 | Not Available | 541 | Open in IMG/M |
| 3300025981|Ga0207640_10574839 | Not Available | 950 | Open in IMG/M |
| 3300026078|Ga0207702_10170453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1995 | Open in IMG/M |
| 3300026088|Ga0207641_10285759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1553 | Open in IMG/M |
| 3300027483|Ga0207637_1002170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 979 | Open in IMG/M |
| 3300027560|Ga0207981_1006970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1999 | Open in IMG/M |
| 3300027560|Ga0207981_1037134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 887 | Open in IMG/M |
| 3300027665|Ga0209983_1049864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 | 915 | Open in IMG/M |
| 3300027682|Ga0209971_1014173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1889 | Open in IMG/M |
| 3300027876|Ga0209974_10049507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1410 | Open in IMG/M |
| 3300027876|Ga0209974_10138649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 871 | Open in IMG/M |
| 3300027907|Ga0207428_10216845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1436 | Open in IMG/M |
| 3300031226|Ga0307497_10357563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 686 | Open in IMG/M |
| 3300031716|Ga0310813_10020139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4539 | Open in IMG/M |
| 3300031716|Ga0310813_10343352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
| 3300031913|Ga0310891_10045219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1215 | Open in IMG/M |
| 3300032144|Ga0315910_10046976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3146 | Open in IMG/M |
| 3300032180|Ga0307471_102460395 | Not Available | 658 | Open in IMG/M |
| 3300032205|Ga0307472_101051901 | Not Available | 767 | Open in IMG/M |
| 3300032421|Ga0310812_10083659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1289 | Open in IMG/M |
| 3300033004|Ga0335084_10361684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1497 | Open in IMG/M |
| 3300033513|Ga0316628_101133207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1041 | Open in IMG/M |
| 3300033551|Ga0247830_10405457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1061 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.46% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.48% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.73% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.73% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.99% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.24% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.24% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.24% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.24% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.75% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.75% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.75% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004062 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027483 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
| 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0832.00006490 | 2162886007 | Switchgrass Rhizosphere | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| 2213874108 | 2209111006 | Arabidopsis Rhizosphere | MTTLPIRAPIVPTLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| ARcpr5oldR_0003803 | 3300000041 | Arabidopsis Rhizosphere | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| NODE_06876574 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MTTLPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQQQAAAAHKRFPLAAW* |
| JGI11643J12802_113759252 | 3300000890 | Soil | MTTLPIRAPIVPPLAGLARVISYFNLAIEVFAEAQQQAAAAHKRFPFADW* |
| JGI1027J12803_1075285062 | 3300000955 | Soil | MTTLPIRAPVVPSLAGFARLISYLDIAIEVFAEVKQQAAEAHKRFPFADW* |
| soilH2_102666203 | 3300003324 | Sugarcane Root And Bulk Soil | MTTLPIRAPMVPPIYGLARILSFFAIVSESFAEARQLAVEAHKRYPFAEW* |
| Ga0055435_102008672 | 3300003994 | Natural And Restored Wetlands | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRFPFAEW* |
| Ga0055500_100574502 | 3300004062 | Natural And Restored Wetlands | MITLPIRVPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRFPFAEW* |
| Ga0062593_1002789563 | 3300004114 | Soil | MTTLPIRVPIVPPLAGLARVILYFNIAIEVFAEAQQQAAEAHKRFPFADW* |
| Ga0062593_1003054311 | 3300004114 | Soil | MTTLPIRAPIVPPLAGLARLISYCNLAIEVFAEAQQHAAAAHKRFPFADW* |
| Ga0062593_1008994252 | 3300004114 | Soil | MTTLPIRAPIVPSLAGLARVIAYFDIAIEVFAEARQQAAAAHKRFPFAEW* |
| Ga0062593_1010370022 | 3300004114 | Soil | MTTLPIHAPIVPSLSGLARVIAYFDIAIDVFVETRQQAIAAHKRYPFADW* |
| Ga0062589_1002351983 | 3300004156 | Soil | MTTLPIRAPIVPSLAGLARVISYFTLAIEVFAEAQQQAAEAHKRFPFAEW* |
| Ga0062589_1002494691 | 3300004156 | Soil | MTTLPIRAPIVPPLAGLARLISYCNLAIEVFAEAQQHAAAA |
| Ga0062589_1011475391 | 3300004156 | Soil | MTTLPIRAPIMPPLAGLARVISYFNFAIEVFTEAQQQAALAHKRFPFAEW* |
| Ga0063356_1061933242 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTTLPIRAPIMPPLAGLARVISYLNIAIEVFAEAQQQAVEAHKRYPFAAW* |
| Ga0062595_1004170733 | 3300004479 | Soil | MTTLPIRAPIVPSLAGLARVISYFTLAIEVFAEAQQQAAEAHRRFPFAEW* |
| Ga0062595_1017630242 | 3300004479 | Soil | MTTLPIRAPIELPFAGFARVMLFCKALIEVFADAQQQANAAHKRYPFAEW* |
| Ga0066808_10082432 | 3300005159 | Soil | MTTLPIRAPIVPSLVGLARVISYFNIAIEVFAEAQQQAAAAHKRFPFAEW* |
| Ga0066809_100599633 | 3300005168 | Soil | PIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0065716_10023465 | 3300005277 | Arabidopsis Rhizosphere | PIRAPIVPTLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0070676_103836703 | 3300005328 | Miscanthus Rhizosphere | MTTLPIRAPIVPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0066388_1002957504 | 3300005332 | Tropical Forest Soil | MTTLPIRAPIVPSLAGLARVLSYFSIAIEVLTEAQQQAAEAHKRFPFAEW* |
| Ga0066388_1024836951 | 3300005332 | Tropical Forest Soil | MTTLPIRAPIVSPLAGFARVFSYFNVLIEAFAEAQQQAAQAHKRFPFADW* |
| Ga0066388_1041385921 | 3300005332 | Tropical Forest Soil | MTTLPIRAPIVPSLAGLARVLSYFNIAIEVFAEAQQQAAAAHKRFPFAEW* |
| Ga0070680_1002623773 | 3300005336 | Corn Rhizosphere | MTTLPIRAPIVPSLVGLARVISYFNIAIEVFAEAQQQATAAHRRFPFAEW* |
| Ga0070660_1000440056 | 3300005339 | Corn Rhizosphere | PIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0070659_1010916893 | 3300005366 | Corn Rhizosphere | RKSEMTTLPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQQQAAAAHKRFPLAAW* |
| Ga0070709_102211733 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLPIRAPIELPFAGFARVISFCKALIEVFAVAQQQANAAHKRYPFAEW* |
| Ga0070701_102267443 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLPIRVPIVPPLAGLARVILYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0070705_1001766873 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLPIRAPIVPPFAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0070663_1008315621 | 3300005455 | Corn Rhizosphere | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHK |
| Ga0070681_105834042 | 3300005458 | Corn Rhizosphere | MTTLPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQEQAAAAHKRFPLAAW* |
| Ga0070681_109074383 | 3300005458 | Corn Rhizosphere | MTTLPIRAPIVLPLAGLSRMISYFNLAIEVFAEAQQQAAAAHKRFPFADW* |
| Ga0070707_1004944802 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLPIRAPIVPPVAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0070741_1000121268 | 3300005529 | Surface Soil | MTTLPIRAPFVPPLSGAARLLSFFRIVIESFSEAQRLAAEAHKRYPFAEW* |
| Ga0070686_1010916411 | 3300005544 | Switchgrass Rhizosphere | LPIRAPIVPSLAGLARVISYFTLAIEVIAEAQQQAAEAHKRFPFAEW* |
| Ga0070693_1012156921 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQQQAAAAHRRFPLAAW* |
| Ga0070702_1005145702 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLPIRAPIVPPLVGLARVISDFNIAIEVFAEAQQQATAAHKRFPFADW* |
| Ga0068852_1002135441 | 3300005616 | Corn Rhizosphere | VPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0066905_1013306042 | 3300005713 | Tropical Forest Soil | MTTLPIRAPVVPSLAGLARVFSYFSIAIEVFTEAQQQAAEAHKRFPFAEW* |
| Ga0066905_1018169722 | 3300005713 | Tropical Forest Soil | MTTLPIRAPIVPSLAGLARLIAYLDLAIEVFAEAQQQAAAAHERFPFAEW* |
| Ga0066905_1019324942 | 3300005713 | Tropical Forest Soil | MTTLPIRAPIVPSFAGLARVLSYFSIAIEVFAESQQQAAEAHKRFPFAEW* |
| Ga0068861_1010704453 | 3300005719 | Switchgrass Rhizosphere | MTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFADW* |
| Ga0066903_1037783962 | 3300005764 | Tropical Forest Soil | MTTLPIRAPIVPSLAGLARVFSYFSIAIEVLTEAQQQAAEAHKRFPFAEW* |
| Ga0068863_1004261051 | 3300005841 | Switchgrass Rhizosphere | RAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0081455_100279278 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTLPIRAPIVPSLAGLARVLSYFSIAIEVFAEAQRQAAEAHKRFPFAEW* |
| Ga0074056_115216252 | 3300006574 | Soil | MTTLPIRAPIVPPLAGLTRVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0074053_100068473 | 3300006575 | Soil | GLARVISYFNIAIEVFAEAQQQAAAAHKRFPFAEW* |
| Ga0079220_101160883 | 3300006806 | Agricultural Soil | MTTLPIRAPIDLPFAGFARVIFFCKALIEVFAEAQQQA |
| Ga0079220_108385492 | 3300006806 | Agricultural Soil | MTTLPIRAPIVPPLAGLARVISYFNLAIEVFAEAQQQAAQAHKRFPFAEW* |
| Ga0079220_110457643 | 3300006806 | Agricultural Soil | MTTLPIRAPIVPSLAGLARVISYFDTALDIFAEAQQQAAEAHKRFPFAAW* |
| Ga0075425_1001679495 | 3300006854 | Populus Rhizosphere | MTTLPIRAPIMPSLPGLARVLSCFNIAIEVFAEAQQQATAAHKRFPFAEW* |
| Ga0068865_1000420811 | 3300006881 | Miscanthus Rhizosphere | PLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0075424_1028400951 | 3300006904 | Populus Rhizosphere | MTTLPIRAPIVPLLVGLARVISYFNIAIEVFAEAQQQATAAHRRFPFAE* |
| Ga0075436_1006896212 | 3300006914 | Populus Rhizosphere | MTTLPIRAPIMPSLPGLARVLSCFNIAIEVFAEAQQQATAAHKRFPFTEW* |
| Ga0105244_105256322 | 3300009036 | Miscanthus Rhizosphere | MTTLPIRVPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0111539_100513138 | 3300009094 | Populus Rhizosphere | MTTLPIRAPTVPSLAGLARVLSYFKISIEVFAEAQQQAAAAHKRFPFAEW* |
| Ga0105245_107265953 | 3300009098 | Miscanthus Rhizosphere | MTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0105243_114709042 | 3300009148 | Miscanthus Rhizosphere | MTTLPIRAPIVRPLVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFADW* |
| Ga0105243_119737922 | 3300009148 | Miscanthus Rhizosphere | MTTLPIRVPIVPPLAGLTRVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0075423_105933661 | 3300009162 | Populus Rhizosphere | NTQKRRTEEMTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0105241_107518681 | 3300009174 | Corn Rhizosphere | PIRAPIVPPFAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0105237_100765072 | 3300009545 | Corn Rhizosphere | MTTLPIRVPIVPPLAGLARVILYFNIAIEVFAEAQQQAAEAHKRFPFAEW* |
| Ga0126384_108699822 | 3300010046 | Tropical Forest Soil | MTTLPIRAPILPSLAGFARVFSYFDVLIEAFAEAQQQAAQAHKRFPFAEW* |
| Ga0126382_122419192 | 3300010047 | Tropical Forest Soil | VPSLAGLARVLSYFSIAIEVFAEAQQQAAAAHKRFPFAEW* |
| Ga0126376_101868494 | 3300010359 | Tropical Forest Soil | PSLAGLARVLSYIDIAIEIFAEAQQQAAAAHKRFPLAAW* |
| Ga0126376_109726462 | 3300010359 | Tropical Forest Soil | MTTLPIRAPIVPSFAGLARLISYLDIAIEAFAEAQKQAAEAHKRYPFAAW* |
| Ga0126376_113804002 | 3300010359 | Tropical Forest Soil | MTTLPIRAPIVLPLAGFARVISYFNILIEAFAEAQQQATQAH |
| Ga0126376_120826422 | 3300010359 | Tropical Forest Soil | MTTLPIRAPIDLPFAGFARVILLCKALLEVFAEAQQQASAAHRRYPFAEW* |
| Ga0126377_102452643 | 3300010362 | Tropical Forest Soil | MTTLPIRAPIVPPLAGFARVISYFNILIEAFAEAQQQAAQAHKRFPFADW* |
| Ga0134125_106549003 | 3300010371 | Terrestrial Soil | MTTLPIRAPIVPSLAGLARVISYFDIAIEVFAEAQQQAAEAHKRFPFAAW* |
| Ga0134125_106703493 | 3300010371 | Terrestrial Soil | MTTLPIRAPIVPSLAGLARMISYFNIAIEVFAEAQQQAAEAHKRFPFAEW* |
| Ga0134126_103066924 | 3300010396 | Terrestrial Soil | MTTLPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQEQAAAAHRRFPLAAW* |
| Ga0134122_120480392 | 3300010400 | Terrestrial Soil | MTTLPIRAPIVPPLAGLARVISYFDIAIEVFAEAQQQAAEAHKRFPFAAW* |
| Ga0134123_136346962 | 3300010403 | Terrestrial Soil | RTEEMTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0157325_10375362 | 3300012485 | Arabidopsis Rhizosphere | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFA |
| Ga0157326_10127541 | 3300012513 | Arabidopsis Rhizosphere | MTTLPIRAPIVPLGGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0157284_101362461 | 3300012893 | Soil | TEEMTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW* |
| Ga0164241_106886732 | 3300012943 | Soil | MTTLPIRAPIVPSLAGLARVIACFNIAIEVFAEAKQQAAEAHKRFPFADW* |
| Ga0164303_101564643 | 3300012957 | Soil | LVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFADW* |
| Ga0164303_104563201 | 3300012957 | Soil | MTTLPIRAPIVPRLVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFA |
| Ga0164308_111473661 | 3300012985 | Soil | RNTPKRRAREMTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFADW |
| Ga0164307_107998862 | 3300012987 | Soil | MTTLPIRAPIVPRLVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFADW* |
| Ga0157371_112317302 | 3300013102 | Corn Rhizosphere | MTTLPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQQQAAAAHRRFPLAAW* |
| Ga0157374_106886882 | 3300013296 | Miscanthus Rhizosphere | MTTLPIRAPIVPSLAGLARVSAYFTLAIEVCAEAQQQAAEAHKRFPFAEW* |
| Ga0163162_131795862 | 3300013306 | Switchgrass Rhizosphere | MTTLPIRAPIVPPLVGLARVISYFNIVIEVFAEAQQQATAAHKCFPFADW* |
| Ga0075351_10520681 | 3300014318 | Natural And Restored Wetlands | MTTLPIRVPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRFPFADW* |
| Ga0182008_102587472 | 3300014497 | Rhizosphere | MTTLPIRAPIVPPLAGLARVISYYFNIAIEVFAEAQQQAAEAHKRFPFAEW* |
| Ga0173483_108300732 | 3300015077 | Soil | MTTLPIRAPIVRPLVGLARVISYFNIAIEVFAVVQQQATAAHKRFPFADW* |
| Ga0132258_106908825 | 3300015371 | Arabidopsis Rhizosphere | MTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQATAAHRRFPFAEW* |
| Ga0132258_114272181 | 3300015371 | Arabidopsis Rhizosphere | RRLVEMTTLPIRAPIVPSLAGLARVISYFDIVIEVFAEAQQQATAAHKRFPFAEW* |
| Ga0132256_1001007392 | 3300015372 | Arabidopsis Rhizosphere | MTTLPIRAPIVPSLAGLARVISYFDIVIEVFAEAQQQATAAHKRFPFAEW* |
| Ga0132257_1009360263 | 3300015373 | Arabidopsis Rhizosphere | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAGW* |
| Ga0132255_1003739721 | 3300015374 | Arabidopsis Rhizosphere | MTTLPIRAPIVPPLVGLARAISYFNIAIEVFAEAQQQATAAHRRFPFAEW* |
| Ga0132255_1026562151 | 3300015374 | Arabidopsis Rhizosphere | MTTLPIRAPIVPSLAGLARVISYFTLAIEVIAEAQQQAAEAHKRFPFAEW* |
| Ga0163161_108169682 | 3300017792 | Switchgrass Rhizosphere | MTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFADW |
| Ga0187825_101786002 | 3300017930 | Freshwater Sediment | MTTLPIRAPIELPFAGFARVKLFCKALIEVFADAQQQANAAHRRYPFAEW |
| Ga0187825_103359163 | 3300017930 | Freshwater Sediment | MTTLPIRAPIELPFAGFARVISFCKALIEVFAVAQQQANAAHKRYPFAEW |
| Ga0173482_100012958 | 3300019361 | Soil | MTTLPIRAPIVPPVAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| Ga0182009_106154282 | 3300021445 | Soil | MTTLPIRAPIVPSLAGLARVISYFTLAIEVFAEAQQQAAEAHRRFPFAEW |
| Ga0247794_102737193 | 3300024055 | Soil | PSLAGLARVISYFTLAIEVFAEAQQQAAEAHKRFPFAEW |
| Ga0207666_10033064 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLPIRAPIVPPFAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| Ga0210132_10046652 | 3300025538 | Natural And Restored Wetlands | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRFPFAEW |
| Ga0207710_100740603 | 3300025900 | Switchgrass Rhizosphere | MTTLPIRAPIVPSLAGLARVISYFTLAIEVFAEAQQQAAEAHKRFPFAEW |
| Ga0207688_102577462 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTLPIRAPIVPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| Ga0207671_110843542 | 3300025914 | Corn Rhizosphere | MTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQATTAHKRFPFAEW |
| Ga0207690_112477981 | 3300025932 | Corn Rhizosphere | MTTLPIRVPIVPPLAGLARVILYFNIAIEVFAEAQQQAAEAQKR |
| Ga0207679_103022301 | 3300025945 | Corn Rhizosphere | KRRTEEMTTLPIRAPIVPSLAGLARVISYFTLAIEVFAEAQQQAAEAHRRFPFAEW |
| Ga0207679_110821682 | 3300025945 | Corn Rhizosphere | MTTLPIRAPIVPSLAGLARVLSYIDIAIEVFAEAQQQAAAAHKRFPLAAW |
| Ga0207668_118729422 | 3300025972 | Switchgrass Rhizosphere | MTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQHAAAAHKRFPFADW |
| Ga0207640_105748394 | 3300025981 | Corn Rhizosphere | PIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQATAAHKRFPFADW |
| Ga0207702_101704531 | 3300026078 | Corn Rhizosphere | PIVPSLAGLARVISYFTLAIEVFAEAQQQAAEAHKRFPFAEW |
| Ga0207641_102857594 | 3300026088 | Switchgrass Rhizosphere | RAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| Ga0207637_10021701 | 3300027483 | Soil | TEEMTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| Ga0207981_10069704 | 3300027560 | Soil | MTTLPIRAPIVPSLVGLARVISYFNIAIEVFAEAQQQAAAAHKRFPFAEW |
| Ga0207981_10371341 | 3300027560 | Soil | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAE |
| Ga0209983_10498642 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MTTLPIRAPIVPPLAGLARLISYFNLAIEVFAEAQQQAAAAHKRFPFADW |
| Ga0209971_10141733 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MTTLPIRAPIVPPLAGLARVISYFNLAIEVFAEAQRQAAAAHKRFPFADW |
| Ga0209974_100495073 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MTTLPIRAPIMPPLAGLARVISYLNIAIEVFAEAQQQAVEAHKRYPFAAW |
| Ga0209974_101386493 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MTTLPIRVPIVPPLAGLARVILYFNIVIEVFAEAQQQAAEAHKRFPFADW |
| Ga0207428_102168452 | 3300027907 | Populus Rhizosphere | MTTLPIRAPTVPSLAGLARVLSYFKISIEVFAEAQQQAAAAHKRFPFAEW |
| Ga0307497_103575632 | 3300031226 | Soil | MTTLPIRAPIMPPLAGLARVISYFNIAIEVFAEAQQQAAEAHKRYPFAAW |
| Ga0310813_100201395 | 3300031716 | Soil | MTTLPIRAPIVPPLAGLARVISYYFNIAIEVFAEAQQQAAEAHKRFPFAEW |
| Ga0310813_103433523 | 3300031716 | Soil | MTTLPIRAPIELPFAGFARVMLFCKALIEVFADAQQQANAAHKRYPFAEW |
| Ga0310891_100452193 | 3300031913 | Soil | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQ |
| Ga0315910_100469765 | 3300032144 | Soil | MTTLPIRAPIVPPLAGLARVISYFNIAIEVFAEAQQQAAAAHKRFPFADW |
| Ga0307471_1024603952 | 3300032180 | Hardwood Forest Soil | MTTLPIRAPIVPSFAGLARLIAYLDLAIEVFAEVQQQAAEAHKRYPFAAW |
| Ga0307472_1010519011 | 3300032205 | Hardwood Forest Soil | MTTLPIRAPIVPPLVGLARVISYFNIAIEVFAEAQQQATAAHRRFPFAEW |
| Ga0310812_100836591 | 3300032421 | Soil | MTTLPIRAPIVPPLAGLARVISYYFNIAIEVFAEAQQQAAEAH |
| Ga0335084_103616843 | 3300033004 | Soil | MTTLPIRVPIVLPLAGLARVISYFNIAIEVFAEAQQQAAEAHKCFPFADW |
| Ga0316628_1011332073 | 3300033513 | Soil | MTTLPIRAPLVPPLAGLARVVSYFQIAIEVLTEAQQHAAAAHKRYPFAEW |
| Ga0247830_104054573 | 3300033551 | Soil | RTIEMTTLPIRAPIVPSLVGLARVISYFNIAVEVFAEAQQQAAAAHKRFPFAEW |
| ⦗Top⦘ |