Scaffold BS_KBA_SWE07_21mDRAFT_c1000108

Overview

Basic Information

• Taxon OID: 3300000134
• Scaffold ID: BS_KBA_SWE07_21mDRAFT_c1000108
• Source Dataset Name: Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 07_21m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 10578
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (30.77%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location

• Location Name: KBA site, Vaertahamnen, Baltic Sea, Sweden
• Coordinates
  • Lat. (^o): 59.363333
  • Long. (^o): 18.119167
  • Depth (m): 21

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049642	Metagenome / Metatranscriptome	146	N

Sequences

Protein ID	Family	RBS	Sequence
BS_KBA_SWE07_21mDRAFT_100010810	F049642	N/A	VKIIVVISGFTQKNYQSTGSKQLWRELRLLKDLCAGEDALIQLKEWDTDWKRYARYINSLEPSEVLICCYXWGGGHGMPQLSKRLQCDVSVVACDPVYHSPTILGRWWALFDRKIKLDKNVTVVGWVSQRGGHLDGDKLVGGKSICKELTYNYSHTEIDNSPEYHQMAVLAATEYLTKI*