| Basic Information | |
|---|---|
| Taxon OID | 3300000129 Open in IMG/M |
| Scaffold ID | KGI_S2_ANT04_2345mDRAFT_c1019394 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 04_23.45m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1807 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | S2 site, Potter Cove, King George Island, Antarctic Peninsula | |||||||
| Coordinates | Lat. (o) | -62.231932 | Long. (o) | -58.655087 | Alt. (m) | Depth (m) | 23.45 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050639 | Metagenome / Metatranscriptome | 145 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| KGI_S2_ANT04_2345mDRAFT_10193941 | F050639 | GGA | MLRWMWRELETGLRNTLNGHEEGNLGYSQGYSLRVTAPVLDPTCVSL |
| ⦗Top⦘ |