3300000129: Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 04_23.45m

Overview

Basic Information

• IMG/M Taxon OID: 3300000129
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063447 | Gp0053470 | Ga0026511
• Sample Name: Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 04_23.45m
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 282842295
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → intertidal zone → marine sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Sediment (saline)

Location Information

• Location: S2 site, Potter Cove, King George Island, Antarctic Peninsula
• Coordinates
  • Lat. (^o): -62.231932
  • Long. (^o): -58.655087
  • Alt. (m): N/A
  • Depth (m): 23.45

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050639	Metagenome / Metatranscriptome	145	Y
F079376	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
KGI_S2_ANT04_2345mDRAFT_c1019394	Not Available	1807
KGI_S2_ANT04_2345mDRAFT_c1056492	Not Available	796

Sequences

Scaffold ID	Protein ID	Family	Sequence
KGI_S2_ANT04_2345mDRAFT_c1019394	KGI_S2_ANT04_2345mDRAFT_10193941	F050639	MLRWMWRELETGLRNTLNGHEEGNLGYSQGYSLRVTAPVLDPTCVSL
KGI_S2_ANT04_2345mDRAFT_c1056492	KGI_S2_ANT04_2345mDRAFT_10564921	F079376	MSDIVIIREPGRPCVSLGTSRVCRTTEEGGRQIKHRESDSLVVPMKAGNAAGGKEATHESVV*