| Basic Information | |
|---|---|
| Taxon OID | 3300000123 Open in IMG/M |
| Scaffold ID | KGI_S2_ANT06_2345mDRAFT_c1009690 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S2 sample ANT 06_23.45m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2895 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | S2 site, Potter Cove, King George Island, Antarctic Peninsula | |||||||
| Coordinates | Lat. (o) | -62.231932 | Long. (o) | -58.655087 | Alt. (m) | Depth (m) | 23.45 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F073087 | Metagenome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| KGI_S2_ANT06_2345mDRAFT_10096903 | F073087 | AGGA | MNTQTSFTKAIIVSTQRLFRSNKNHSLLATNCIDACTARDIGFNPVGQF* |
| ⦗Top⦘ |