Scaffold HighMDraftT1_c101808

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold HighMDraftT1_c101808

Scaffold HighMDraftT1_c101808

Overview

Basic Information
Taxon OID	3300000079 Open in IMG/M
Scaffold ID	HighMDraftT1_c101808 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from New Zealand - High methane
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	729
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Cattle And Sheep Rumen Microbial Communities From New Zealand, For Comparative Studies

Source Dataset Sampling Location
Location Name	New Zealand
Coordinates	Lat. (^o)	-42.26	Long. (^o)	171.6	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050059	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
HighMDraftT1_1018081	F050059	N/A	ARGTALWESLVGKPRGKDTRENHRCFDPRGGLRDTAATALEESASACPHSRRGLTPLGRLQKYPKIHVSTGEESSGSGPDSTQGLRPRHRRESNPERPPRNSPGDWPFLRPAERVPEVPVVSREHLPQLEKIQEVLPSRRDEAHFR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.