Scaffold Draft_c059662

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Draft_c059662

Scaffold Draft_c059662

Overview

Basic Information
Taxon OID	3300000053 Open in IMG/M
Scaffold ID	Draft_c059662 Open in IMG/M
Source Dataset Name	Coal bed methane well microbial communities from Alberta, Canada
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1031
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Alberta, Canada
Coordinates	Lat. (^o)	52.119	Long. (^o)	-113.78	Alt. (m)		Depth (m)	686
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054611	Metagenome / Metatranscriptome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Draft_0596622	F054611	N/A	MXDIXXERLQTLMEXVNKENPDLDPYVIWVICVNYLLNEQGIYGDEEIAKQLREQRNHELKYDIKVI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.