Scaffold ARcpr5oldR_c010296

Overview

Basic Information

• Taxon OID: 3300000041
• Scaffold ID: ARcpr5oldR_c010296
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 796
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere → Arabidopsis Rhizosphere Microbial Communities From The University Of North Carolina

Source Dataset Sampling Location

• Location Name: USA: Bethesda, Maryland
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082938	Metagenome / Metatranscriptome	113	N

Sequences

Protein ID	Family	RBS	Sequence
ARcpr5oldR_0102962	F082938	GGAGG	MPTSEDYRQMANRTAQIAIACSAPSVAGALLALAVEYMALADGLNPRAFAAEQQLQEMQQDPVGYGD*