NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold IMNBGM34_c043421

Scaffold IMNBGM34_c043421


Overview

Basic Information
Taxon OID3300000036 Open in IMG/M
Scaffold IDIMNBGM34_c043421 Open in IMG/M
Source Dataset NamePassalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)584
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Passalidae Beetle Gut → Passalidae Beetle Gut Microbial Communities From Costa Rica

Source Dataset Sampling Location
Location NameQuebrada Gonzales Sector, Braulio Carrillo National Park, Costa Rica
CoordinatesLat. (o)10.207151Long. (o)-84.007673Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036529Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
IMNBGM34_0434212F036529N/APFPFYFFLAQEIPQPNPEALSTWLVDAAALAAILLVFLKVLDHFKRRPSLEQELEKLLRQLRTELNQLRGEQAEHLAEVRLRVEGAHQRVDHLTHDLNNKLQRLPGEIVDILHKTGVLKGH*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.