| Basic Information | |
|---|---|
| Taxon OID | 3300000036 Open in IMG/M |
| Scaffold ID | IMNBGM34_c002314 Open in IMG/M |
| Source Dataset Name | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2822 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Passalidae Beetle Gut → Passalidae Beetle Gut Microbial Communities From Costa Rica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Quebrada Gonzales Sector, Braulio Carrillo National Park, Costa Rica | |||||||
| Coordinates | Lat. (o) | 10.207151 | Long. (o) | -84.007673 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F098791 | Metagenome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| IMNBGM34_0023147 | F098791 | GGAGG | MAFPKNANEMKAANYRFDDYATCRGCDDEIEWWITPTGKKIPMNPMPRGTSEAIAHWITCIESDLFRGKR* |
| ⦗Top⦘ |