Scaffold LD2009400mD_c02782

Overview

Basic Information

• Taxon OID: 2263196002
• Scaffold ID: LD2009400mD_c02782
• Source Dataset Name: April 2009 400 m contigs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Royal Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1291
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine (Brackish) → Marine Microbial Communities From Depth Transect At Landsort Deep In The Baltic Sea

Source Dataset Sampling Location

• Location Name: Landsort Deep, Baltic Sea
• Coordinates
  • Lat. (^o): 58.583333
  • Long. (^o): 18.233333
  • Depth (m): 400

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025141	Metagenome / Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
LD2009400mD_027822	F025141	N/A	MIQCEYCPRGFIETVNGLAEKTFHELLHEPTVVNK