| Basic Information | |
|---|---|
| Taxon OID | 2236876017 Open in IMG/M |
| Scaffold ID | SS13_p0981254 Open in IMG/M |
| Source Dataset Name | Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS13 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 501 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Spain: Bras del Port | |||||||
| Coordinates | Lat. (o) | 38.11 | Long. (o) | -0.36 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019144 | Metagenome / Metatranscriptome | 231 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SS13_09812542 | F019144 | GGAG | MQGIQDNAHRVADNLAATSVLGAITANLPIITEWMQMIAALIGICSGLAALRFYLKRTSQLDGEE |
| ⦗Top⦘ |