Scaffold none_p224308

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold none_p224308

Scaffold none_p224308

Overview

Basic Information
Taxon OID	2236876011 Open in IMG/M
Scaffold ID	none_p224308 Open in IMG/M
Source Dataset Name	Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-3LG-Hyp-75m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of South Carolina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	529
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Newport Hydroline 10 km (NH10)
Coordinates	Lat. (^o)	44.651	Long. (^o)	-124.295	Alt. (m)		Depth (m)	75
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052545	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
none_2243081	F052545	N/A	MSTDSSIMIRTPFKAKEFDGNKEDDQLDAGAWCLGRMGGSWVPAMYLCGTQSEAEGIRDEFLESMVEDEDDCQP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.