| Basic Information | |
|---|---|
| Taxon OID | 2236876011 Open in IMG/M |
| Scaffold ID | none_p169359 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-3LG-Hyp-75m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of South Carolina |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 514 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Newport Hydroline 10 km (NH10) | |||||||
| Coordinates | Lat. (o) | 44.651 | Long. (o) | -124.295 | Alt. (m) | Depth (m) | 75 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018173 | Metagenome / Metatranscriptome | 236 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| none_1693591 | F018173 | N/A | YPYDQTITDTDAWVGTDSVNRQTKQYTAKAVADYLNINGKVAIAGQMNYQFVQDPSFKSGTFAFAAGSGGGTPWSSITSIVISNMDLSGQVVSPFLEYLVDEQVLFQDVAGKGSFGHYIMRGYTQIGTTNFYTLTLEYIGVMDL |
| ⦗Top⦘ |