Scaffold none_p0267995

Overview

Basic Information

• Taxon OID: 2236876010
• Scaffold ID: none_p0267995
• Source Dataset Name: Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p1-Hyp-75m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 562
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Newport Hydroline 10 km (NH10)
• Coordinates
  • Lat. (^o): 44.651
  • Long. (^o): -124.295
  • Depth (m): 75

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092698	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
none_02679951	F092698	N/A	SIIGCCGFRKNIKFAVSLETKRSTLVSEASPTSAITAVRNKYV