Basic Information | |
---|---|
Taxon OID | 2236876003 Open in IMG/M |
Scaffold ID | none_p053072 Open in IMG/M |
Source Dataset Name | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p8-ETM-15m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of South Carolina |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 521 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River estuary, South channel near Astoria | |||||||
Coordinates | Lat. (o) | 46.249 | Long. (o) | -123.986 | Alt. (m) | Depth (m) | 15 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042310 | Metagenome / Metatranscriptome | 158 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
none_0530721 | F042310 | AGGTGG | MAKLEVIEQYGYNEQGICINPFGIKPLWVQKLAERIRCNHVVTMAEEAPF |
⦗Top⦘ |