Scaffold none_p146909

Overview

Basic Information

• Taxon OID: 2236876001
• Scaffold ID: none_p146909
• Source Dataset Name: Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmax
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Columbia River Transect 7 km from mouth (CR7)
• Coordinates
  • Lat. (^o): 46.167
  • Long. (^o): -124.158
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F095321	Metagenome	105	N

Sequences

Protein ID	Family	RBS	Sequence
none_1469092	F095321	N/A	RFLKIKNWKIRIVANNKEMISPGEYKNIEILPKLFEMYRHYYKLNTKGKG