| Basic Information | |
|---|---|
| Taxon OID | 2236661024 Open in IMG/M |
| Scaffold ID | TM7x89Draft_c00836 Open in IMG/M |
| Source Dataset Name | Human oral microbial communities from Stanford University, California, USA - TM7-9 pangenome assembly 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oak Ridge National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1737 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral → Human Oral Microbial Communities From Stanford University, California, Usa (12) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oak Ridge TN | |||||||
| Coordinates | Lat. (o) | 35.92634 | Long. (o) | -84.31646 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066860 | Metagenome | 126 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| TM7x89Draft_008362 | F066860 | N/A | MTTKKQKLQKQQAIDTWIVIALWVSAIWFSLARGFITGIGGWVLALLGPWALIVSCICLAIISRQMKKRHASKDHLTTIVRVSFIVMSISLFIYGLAMPDFSDMETFSTLSVYTNNAISFKTSKTIAIISGFVVVLSLFVAVTFGIAEDKE |
| ⦗Top⦘ |