| Basic Information | |
|---|---|
| Taxon OID | 2228664018 Open in IMG/M |
| Scaffold ID | AmiMGMT1_c411545 Open in IMG/M |
| Source Dataset Name | Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 658 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Hindgut → P3 Segment → Termite Hindgut → Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Arizona, USA | |||||||
| Coordinates | Lat. (o) | 31.519 | Long. (o) | -110.001 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031909 | Metagenome | 181 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AmiMGMT1_4115452 | F031909 | N/A | MEVKMTFYMKKVMHRVKTTMKMILVAVTMIFWVSMMN |
| ⦗Top⦘ |