Scaffold AmiMGMT1_c411427

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold AmiMGMT1_c411427

Scaffold AmiMGMT1_c411427

Overview

Basic Information
Taxon OID	2228664018 Open in IMG/M
Scaffold ID	AmiMGMT1_c411427 Open in IMG/M
Source Dataset Name	Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	516
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Hindgut → P3 Segment → Termite Hindgut → Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa

Source Dataset Sampling Location
Location Name	Arizona, USA
Coordinates	Lat. (^o)	31.519	Long. (^o)	-110.001	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001073	Metagenome	786	Y

Sequences

Protein ID	Family	RBS	Sequence
AmiMGMT1_4114272	F001073	N/A	VVAAHYKKDDLLNCCTNSSDISGYHADFQEGHGTVGAWQGHGMACVN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.