Basic Information | |
---|---|
Taxon OID | 2228664018 Open in IMG/M |
Scaffold ID | AmiMGMT1_c411427 Open in IMG/M |
Source Dataset Name | Amitermes wheeleri hindgut microbial communities from Arizona, USA - 3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 516 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Hindgut → P3 Segment → Termite Hindgut → Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Arizona, USA | |||||||
Coordinates | Lat. (o) | 31.519 | Long. (o) | -110.001 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001073 | Metagenome | 786 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
AmiMGMT1_4114272 | F001073 | N/A | VVAAHYKKDDLLNCCTNSSDISGYHADFQEGHGTVGAWQGHGMACVN |
⦗Top⦘ |