 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 2228664014 Open in IMG/M |
| Scaffold ID | PheDRAFT_GXW9OCQ03GDLC6.20596 Open in IMG/M |
| Source Dataset Name | Contaminated soil microbial communities from Tipperary, Ireland - enriched with phenanthrene, cDNA isolated at day 31 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Liverpool |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 511 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Contaminated Soil → Contaminated Soil Microbial Communities From Tipperary, Ireland, In A Timber Treatment Facility |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ireland: Spaights timber treatment facility, Tipperary | |||||||
| Coordinates | Lat. (o) | 52.512199 | Long. (o) | -8.226278 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024800 | Metagenome / Metatranscriptome | 204 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PheDRAFT_00075940 | F024800 | GAGG | VARGQRTAKSGGCPRANGGDAETKSRACLHQVRRPVAQPSAQAGQEASLEIQRARAAGRPCYEAERTPLAVENSVGKPAADPTQGAQCRPGKESVASSHPHFGPCPAARPGR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |