Scaffold PheDRAFT_GXW9OCQ03GD2JJ.25024

Overview

Basic Information

• Taxon OID: 2228664014
• Scaffold ID: PheDRAFT_GXW9OCQ03GD2JJ.25024
• Source Dataset Name: Contaminated soil microbial communities from Tipperary, Ireland - enriched with phenanthrene, cDNA isolated at day 31
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Liverpool
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 510
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Contaminated Soil → Contaminated Soil Microbial Communities From Tipperary, Ireland, In A Timber Treatment Facility

Source Dataset Sampling Location

• Location Name: Ireland: Spaights timber treatment facility, Tipperary
• Coordinates
  • Lat. (^o): 52.512199
  • Long. (^o): -8.226278

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001633	Metagenome / Metatranscriptome	660	Y

Sequences

Protein ID	Family	RBS	Sequence
PheDRAFT_00076490	F001633	N/A	VRHALFPGGTRLDALAFAGDVLPDATLRGMRMYQSHGGTVLTVTGRDLSSEASAPGSDTPCREWRAGRGADTPATFISRVAHLYREDGINLWLIVGLALRV